KEGG   Acropora digitifera (stony coral): 107348916Help
Entry
107348916         CDS       T04352                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf00020  Citrate cycle (TCA cycle)
adf00190  Oxidative phosphorylation
adf01100  Metabolic pathways
adf01200  Carbon metabolism
Module
adf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
adf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
adf_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:adf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107348916
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107348916
Enzymes [BR:adf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107348916
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C TBP
Motif
Other DBs
NCBI-GeneID: 107348916
NCBI-ProteinID: XP_015770490
LinkDB All DBs
Position
Un
AA seq 463 aa AA seqDB search
FQLENYGMPFSRTEKGQIYQRAFGGQSYNYGKGGQAHRCCAVADRTGHSLLHTLYGQSLM
YETEYFVEYFALDLLMDKGKCVGVIALCLEDGSLHRFRAKNTVIATGGYGRAYFSCTSAH
TCTGDGTAMTARAGLPNQDMEFVQFHPTGIYGAGCLITEGSRGEGGYLINSEVNRIPSTK
FGNCGGLGRGNICRGVGVKWKNERVHYNMGGIPTNYMGQVLTLKDGKDDVVPGLWAAGES
ACASVHGANRLGANSLLDLVVFGRACANFISKFHKPSESIPELPANAGEESVSNLDKIRY
ANGGTPTADLRMNMQKTMQTHAAVFRTGSVLLEGCQKIDEIYNQTEDLKLFDRGMVWNTD
LVEALELQNLLINCKQTLYSAEARKESRGAHAREDFKERIDEYDYSKPLDGQTKRPSNQH
WRKHTLSWTDHNTGKVALNYRAVIDETLDQKDCATVPPAVRSY
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
tttcagcttgaaaactatggcatgccattcagtcgcacagaaaagggccaaatttatcag
agagcatttggtggacagagttataattacggaaaaggtgggcaggctcatagatgctgt
gctgttgctgataggacaggacattctctgctgcatacactatatgggcagtcactgatg
tatgaaacagaatattttgtggaatattttgctctggatctgctgatggacaaaggaaaa
tgtgtgggtgtcattgcattgtgtctcgaggatggttcactgcacaggttcagagccaag
aatacagtcatagctactggtggctatggcagagcgtacttctcctgtacatctgcccac
acttgtacaggtgatggcacagccatgacagcgcgagcaggactgccaaaccaggacatg
gaattcgtacagtttcatccaacaggaatttatggagcaggatgtctcattactgaggga
agtcgcggggaaggtggttatcttatcaacagtgaggtaaatcgcattccctcaaccaaa
tttggtaactgtggaggattggggcgaggaaatatttgccgaggagtaggagttaagtgg
aaaaatgagcgagttcattacaacatggggggcatcccaaccaattacatgggacaggtg
ttgacgttgaaggatggaaaagacgatgtggttccagggttgtgggccgcaggagaatcg
gcgtgcgcgtccgtgcacggcgccaacagactgggcgctaattccttacttgacttagtc
gtgtttggtcgcgcatgcgccaattttatctcaaagttccacaagccgtctgagtccatt
cctgaacttcctgcgaatgctggagaagaatccgtatccaatttggacaagattcgctac
gccaatggcggaacacctactgcagatttgagaatgaacatgcaaaagactatgcaaacc
catgcagctgtgttcagaactggatcagtgttgttagaaggctgccagaagattgatgaa
atttacaaccaaaccgaggacctgaagctttttgatcgtggtatggtgtggaacacagat
ctggtggaagccctcgagctgcagaatcttctcattaactgcaaacagactctgtatagt
gccgaggctcgcaaagaaagccgtggtgcgcatgcccgtgaggacttcaaggagcgaatt
gacgagtacgactactcgaaaccattggacggccaaaccaagcgaccctctaaccaacat
tggaggaaacacaccctgtcctggactgatcacaacactggcaaggtggcactgaattat
cgcgctgtcatagatgaaacattggaccagaaggactgtgccacagtcccaccagccgtg
agatcctactaa

DBGET integrated database retrieval system