KEGG   Acropora digitifera (stony coral): 107356234
Entry
107356234         CDS       T04352                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
adf  Acropora digitifera (stony coral)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 TUG-UBL1 Ras_bdg_2 Mst1_SARAH FERM_f0 4HB_MCP_1
Other DBs
NCBI-GeneID: 107356234
NCBI-ProteinID: XP_015778357
LinkDB
Position
Un
AA seq 493 aa
MFTKEENTVIDSRGKRLQSWLFLRVLLAFERGVYSLLYYLTLMESDEVFASDGAGFRKQL
SSRSPSEFKTLTSADSRDRSRPFSVSNLPSGASNKPTSPSSHNPVKDFIANFVNRKGAKK
RAGLKRSVTTENVTDESAPVRNIGRGHSFLPCHLRNPTWCDCCGEFIWGLFKQCVRCKNC
KYTCHKRCQENVDLDCTGGWHLGRNNSVDEITMKTLHLIEQDDKRKEPFTLYTEPPTGSL
LRKKIDEFNSSTTGLIMTMRGVNTFQGFIRVQMNLLRPINIIAGESPLSIFDPAQKEEDH
RNPQRTSFFIPSGTSKALHVTSETTVHEVIVALLKKFKVADNPRKFALFECFQEENKHII
LRPMSDMEKPLVLRLLWGGADLRHNFSLQENETGDIVWDVFSLPELQNFMKILDKEEEEH
ILQVKAKYQTYKERLDKALALVEGDKPVREQKSPVRNHISEEKSSGDKHLRNQVQETIHK
AVDPAQMCDESDC
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgttcactaaagaagaaaacacagttattgactcaagagggaagcgtctacaaagctgg
ttgttcctgcgagtattgctcgcgtttgaacgaggtgtatattcgcttctttactacttg
acactgatggaaagcgacgaagtgtttgccagcgatggagctggatttaggaagcagctc
tcttcaagaagcccttcagagtttaaaactctcacatcagctgatagcagagacaggtct
cggcctttttccgtgtctaatttaccaagcggagcttcaaacaagccaacctcccctagt
tctcacaaccctgtcaaggacttcatcgcaaattttgtgaaccgaaaaggagcgaagaaa
cgggctggtttaaaacgctccgtgacgacagaaaatgtgactgatgaatcagctcccgtc
cgaaacattggaagaggacactcattcctcccttgtcatttacgaaatccaacttggtgt
gactgttgtggagagtttatttggggacttttcaaacagtgtgtgcgatgtaaaaattgc
aagtacacatgccataaacgatgccaagaaaatgtagatttggattgcactggtggctgg
catttaggaagaaataactcagttgatgaaatcaccatgaaaacattacatctcatagaa
caggatgacaagaggaaagagcccttcacgctttatactgagcccccaacaggaagcctt
ctgcggaaaaagattgatgaattcaattcctcaacaacaggacttataatgacaatgaga
ggggtaaacacattccaaggttttatacgcgttcagatgaatctacttcgccccattaac
atcattgctggcgagagtccattatcgatatttgatccagcacaaaaggaagaagatcac
cggaatccacagagaacttcatttttcattcctagtggaacatcaaaagctcttcatgtt
acaagtgaaaccacagtccatgaggtgattgtggctctcctgaaaaaattcaaggttgct
gataatcctagaaaatttgctttgtttgagtgttttcaagaagaaaataaacacattatc
cttcgtcccatgtcagacatggagaagcctcttgttttgaggttgctgtggggtggagct
gacctcagacataacttttcactgcaggagaatgaaacgggggatattgtttgggatgtt
ttcagcctgcctgagcttcaaaacttcatgaaaatacttgataaagaggaggaagaacat
attttgcaggtgaaggcaaaataccagacctacaaagaaagactagacaaggctttagcc
ttggtagaaggagataaacctgtgagagaacaaaaatcaccagtgagaaatcacatttca
gaggagaaatcatcaggcgacaagcatctgagaaatcaagttcaagagacaatacataag
gctgttgatccagcacagatgtgtgatgagagtgattgttga

DBGET integrated database retrieval system