KEGG   Acropora digitifera (stony coral): 107356546Help
Entry
107356546         CDS       T04352                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf00052  Galactose metabolism
adf00500  Starch and sucrose metabolism
adf01100  Metabolic pathways
adf04142  Lysosome
Brite
KEGG Orthology (KO) [BR:adf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107356546
   00500 Starch and sucrose metabolism
    107356546
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107356546
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:adf04147]
    107356546
Enzymes [BR:adf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107356546
Exosome [BR:adf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107356546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Trefoil NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 107356546
NCBI-ProteinID: XP_015778633
LinkDB All DBs
Position
Un
AA seq 868 aa AA seqDB search
MNGRSIVFLLAFSSILHNGNSQEGCSNIPDSNRFDCYPESDVDEQKCLNRGCCWKVAAQD
NQAVDGEIPLNIPYCFYPTNYGYKLVTKTQTPTGYMLTLEKQGNPGPYGKDIQDLIVDLR
FETKDRLHFKVWNIARVAPRPQFNVKHAKFISIVLYRFNSGVGGMVYEDQFIQISSLLPS
TFLYGLGEHVNPLLLDVNWTRATLFARDQGNPEGLLNLYGVFPYYMSLENDGNANGVFLL
NSNAMDIVLQPTPAITYRTIGGILDFYVFLGPTPDLVVSQFTEVVGLPYMPPYWALGFHL
CRWGYGSLNGTMAVNEKMRQYGIPQDVQWNDIEYMDRHLDFTVDKNKWGGLGDFVKTLHD
KYHQHYIPIVDPGISSTQPRGSYPAYDEGLQMGVFINSSNGETFIGQVWPGLTAFPDFSY
PGTQDYWDKMLAQFRNLVEFDGLWIDMNEPSNFFDGSKQGCPASSPLDNPPYVPHVSGGR
LYAKTVCMSTKHHQYTHYDVHSLYGLMEMQRTMSALKKLRGKRSVVISRSTFPSAGLHGG
HWLGDNTATFNDLYLSIPGILNFNMFGVPLVGADICGFNGNTNKELCARWTQLGAFYPFS
RNHNTKGAISQDPTAFGSDFAAMARDVLLTRYRFIPYLYTLFARAHATGSAVARPLFYEX
VHFSSTYGIDRQFLLGPALLITPVLTQGSSSVQGYFPNATWYDGMVGSILQAAGGGGQYH
TLDAPWDKINFHIRGGHVIPTQKPDITTYQSRQNPFELIVALSSLGKAKGILFIDDGESL
EPLQTAAHMFVAYEVSQGTLEAKVYPFRFHESLPPLSTVQVFGVSGQPSSVTVNGSPVHN
FNYNVSTKVLTVEKLGLPMDKGFNITWS
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgaacggaaggtccatcgtcttccttttagcgttttcatcgattctgcacaatggaaac
agccaggagggctgcagcaatattccagacagcaatcgtttcgattgctatcctgaatcg
gatgtcgacgaacaaaaatgcttaaatcgtggatgttgctggaaggtagctgctcaggat
aaccaagctgtagatggggaaattccccttaatattccctactgtttttatccgaccaac
tatggatacaagcttgtaactaagacacaaactccgacgggatacatgctaacgttagaa
aaacagggaaatccaggaccttacggcaaagatatacaagatctgatcgtcgatcttcga
ttcgagacaaaagacaggctgcattttaaggtatggaatattgcaagggtggcacctcgc
cctcagtttaatgtaaaacatgcaaaattcatctcaattgttctgtatagatttaatagt
ggagtaggaggaatggtatatgaggatcagttcattcaaatttcttcactcttgccatca
acatttttgtatggtcttggtgaacacgtcaatccattactccttgatgtcaactggaca
agggcaacgttgtttgcacgagatcagggaaatccagagggcctcttaaatttgtatggt
gtgtttccctattacatgtcgttggaaaatgatggaaatgcaaatggagtgttccttttg
aatagcaatgcaatggacattgttctgcaaccaacaccagctataacttacaggacaatt
ggaggaatcctggatttttatgtgttcttgggacccactccggatcttgttgtctcacaa
ttcacagaagtcgttggactcccttacatgcctccttactgggcccttggttttcacctg
tgtcgttgggggtatggcagcttaaatggaaccatggcagtcaatgaaaagatgcggcag
tatggcattcctcaagatgtacagtggaatgacattgaatacatggacagacatctggac
ttcactgttgacaagaacaagtggggtgggcttggagattttgtcaagactttgcatgac
aagtatcaccaacattatataccgattgtggatcctggcataagttctacacagcctcga
ggttcctatccagcttatgatgaaggccttcagatgggtgttttcattaattcctcaaat
ggagaaacattcattggtcaagtgtggccaggccttaccgctttcccagacttcagttac
ccagggactcaggattactgggacaagatgctggcacagttcagaaaccttgtcgaattt
gacggtctgtggattgacatgaacgagccgtccaatttttttgatgggtctaaacaagga
tgcccagctagttcacccctagacaatcctccttacgttccacatgtctccggaggccgc
ctgtatgcgaagactgtgtgcatgtccacgaagcatcatcaatatacacattatgatgtg
cacagtttgtatggactcatggaaatgcaaaggacaatgagtgcactaaagaaactcaga
ggaaagcgaagtgttgtgatttctcgctcaacctttcccagtgctggcctgcatggtggt
cactggttaggagacaacaccgccacattcaacgacttatatctttcgataccaggaatc
ttgaacttcaatatgtttggtgtccctctggttggagcagacatctgtggttttaatggc
aacaccaataaagaactttgcgcgaggtggacacagctaggagcattttatcctttttca
aggaatcacaacacaaaaggcgccatatcccaggatcccacagcctttggctctgacttc
gctgctatggcacgtgacgtactactgacgcgttaccggttcataccatatttgtacaca
ctattcgctagagcacacgcaacaggttctgcagtagctcggcctcttttctacgagtaa
gtacacttctcgagcacgtacggaatcgatcggcagttccttcttggtccggcattgctc
ataacaccagtgttgacacagggatcctcgtccgtccaaggctacttcccaaatgcaaca
tggtatgacggcatggttggctcaatcctgcaagccgcagggggagggggacaataccac
acactggatgccccttgggacaagatcaactttcatatcagaggaggacacgtgataccg
acccaaaaacctgacatcaccacttatcaaagtcgtcaaaatccatttgagctgattgtc
gctctctcatcgctcgggaaagcaaagggcatcttgtttatcgatgatggagagtcacta
gaacccttacagacagccgcacacatgtttgtcgcttacgaagtctcgcagggtacatta
gaggcaaaggtttatcctttccgttttcatgagtcgctgccaccactgtccaccgtgcaa
gtatttggcgtttctggacagcctagctcagtcacagtcaacggttcccctgtacacaac
ttcaactataacgtatcaacaaaggttctcactgttgaaaaactcggtctaccaatggac
aaaggtttcaatataacttggtcctga

DBGET integrated database retrieval system