KEGG   Acropora digitifera (stony coral): 107358411
Entry
107358411         CDS       T04352                                 

Definition
(RefSeq) caspase-3-like
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:adf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    107358411
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:adf01002]
    107358411
Enzymes [BR:adf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     107358411
Peptidases and inhibitors [BR:adf01002]
 Cysteine peptidases
  Family C14: caspase family
   107358411
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 107358411
NCBI-ProteinID: XP_015780504
LinkDB
Position
Un
AA seq 286 aa
MKRTWLLLCYLVFLIDPITNWHFDVLIAAHVHGQETSGYGIDRDQSNDNDQINYIAKTGY
ALVINNGRESPVRSVSDEDVKMLVDLLWDFGFQIRESRDLERRNMMNLLKDTSEKDFTKY
DCFVCIILSYGPKDRIYGTDDQVITLEAITSLFHRDACPSLQGKPKIFLFQACRGTQRDW
VSTESDSDPICYSKPSLPPYADFLICSASAPGHENYWKDSVGLRFIRAVHKVFKKHAYKE
HIMDMMLRVYDEVAGYLSIQGLKQMPCEIYCMLTKKVFFQPRLNVP
NT seq 861 nt   +upstreamnt  +downstreamnt
atgaagagaacatggctgttattatgctatcttgtattcctgattgatccaataactaac
tggcattttgatgttttgattgcagcacatgttcatggccaggaaacttctggttatggt
atcgaccgtgatcaaagtaatgataatgatcaaatcaactacatagcaaaaactgggtat
gccttagtgatcaacaatggaagggaaagccctgtacgctccgtctcagatgaagatgtc
aaaatgcttgttgatcttttgtgggactttgggttccagataagagaaagtagggatcta
gaaagaaggaatatgatgaacttacttaaagacacttcagaaaaagacttcacaaagtac
gactgctttgtgtgtatcatcctaagctatgggccaaaagacagaatttatggaacggat
gaccaagttatcacgcttgaagccattacatctttattccatcgcgatgcatgtccctcc
cttcaagggaaacccaaaatattcctttttcaagcttgtcgagggacccaacgtgattgg
gtttcaactgaaagtgatagtgaccccatttgttactcaaagccaagtttgccaccatat
gcagattttcttatttgctctgcttctgcacctggtcatgagaattactggaaggattca
gttggtttgaggttcatacgcgcagtacacaaagtgttcaagaagcatgcttacaaggaa
cacatcatggatatgatgttgagagtgtatgatgaagttgctggttatttaagtatccaa
ggcctcaagcaaatgccatgcgagatctactgcatgcttacaaagaaagtgttctttcaa
ccaagactgaatgtaccttga

DBGET integrated database retrieval system