KEGG   Ammonifex degensii: Adeg_1108Help
Entry
Adeg_1108         CDS       T00994                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
adg  Ammonifex degensii
Pathway
adg00473  D-Alanine metabolism
adg00550  Peptidoglycan biosynthesis
adg01100  Metabolic pathways
adg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:adg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Adeg_1108
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Adeg_1108
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Adeg_1108
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:adg01011]
    Adeg_1108
Enzymes [BR:adg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Adeg_1108
Peptidoglycan biosynthesis and degradation proteins [BR:adg01011]
 Precursor biosynthesis
  Amino acid ligase
   Adeg_1108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 ATP-grasp GARS_A ATPgrasp_ST RimK ATP-grasp_4 ATPgrasp_YheCD TTL ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ACX52234
UniProt: C9RDA7
LinkDB All DBs
Position
1122621..1123547
Genome map
AA seq 308 aa AA seqDB search
MRVAVLCGGNSAEREVSLRSGEAVYRALQERGWEAVKIDVGPDIALRLSEVKPDVVFLAL
HGKGGEDGSIQGLLEVMGLPYTGPGILASALAMNKIATKRYLRSASLPTPDFITLDKEET
HDEWLQRVKEFRPFPVVVKAPTQGSSLGMNIVRREEELLPALAEAFRYDPVVLVEEFIEG
VEVTAAVLGNRKPVVLPLIEIVADKGVYDYEAKYTPGKSQHIIPPRLPEPWQEKVKELAL
ATYRWLDCRGFSRIDFMVDHKGNPYILEVNTIPGLTEVSLFPDAARAAGISFGELVERLI
YLALGREE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtggcggtgctgtgcggcggaaactcggccgaaagggaagtttctttgcgctcg
ggcgaagccgtataccgggccttgcaggaaaggggctgggaagcagtaaaaatcgatgta
ggaccagacattgccctacggttaagcgaagtcaagccagacgtggtcttcttggccctg
cacggcaaagggggggaggacggcagcatccaggggcttttggaggtcatgggcctgccc
tacaccgggccgggcattcttgccagcgccctagccatgaacaagatagccaccaagcgt
tacctgcgttcggcttcccttcccacccccgacttcataaccttagataaagaagagact
cacgatgaatggttgcaaagggtaaaagagtttcgtcccttcccggtggtggtcaaggct
cctactcagggttcctctctaggcatgaacatcgtgcgccgggaagaggagctactcccg
gccctggcagaagctttccgctacgacccggtggtactagtagaggagttcatagaagga
gtggaagtaacagcggcggtgctgggcaaccggaagccggtggtgcttcccctcatcgag
atcgtagctgacaaaggagtttacgactacgaggccaagtacacccccgggaaaagccag
cacatcatccctccccgtcttcccgaaccttggcaagaaaaagtgaaggagctggctctg
gctacctaccgctggcttgactgccgggggttctcgcgcatcgacttcatggtagaccat
aaagggaacccctacatcctggaggtcaacaccattccggggcttaccgaggtaagcctc
tttcccgatgccgcccgtgcggccggtataagcttcggcgaactggtagaaaggcttatc
tacctggccctgggacgggaggagtaa

DBGET integrated database retrieval system