KEGG   Ammonifex degensii: Adeg_1863Help
Entry
Adeg_1863         CDS       T00994                                 

Definition
(GenBank) ribulose bisphosphate carboxylase, type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
adg  Ammonifex degensii
Pathway
adg00630  Glyoxylate and dicarboxylate metabolism
adg01100  Metabolic pathways
adg01120  Microbial metabolism in diverse environments
adg01200  Carbon metabolism
Module
adg_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:adg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Adeg_1863
Enzymes [BR:adg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Adeg_1863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ACX52946
UniProt: C9R9G7
LinkDB All DBs
Position
complement(1863055..1864320)
Genome map
AA seq 421 aa AA seqDB search
MRYSDFVELNYTPSPSDCLACFYVEPAEGVDIYEAAGAVASESSIGTWTDVATMKPRIWE
ELRARVYAIEGNVVKIAYPAALFEPGNIPQYLSSIAGNIFGMKAVKNLRLLDISFPPELV
SGSLGPAFGVQGVRETLGIYGRPLVGTIVKPKLGLSPREQAEVVYEALVGGLDLVKDDEN
LTSQPFSPFEERVKRSLEACARAEAEAGEKKVYLPNVTAETEEMIRRAELVKREGGRYVM
VDIVTAGFSGLLSLRKANLGLIIHAHRAMYASFARNRRHGISMLVLAKLARLAGVDQLHI
GTVVGKMEGDKEDVLRCHAALGNASPVSGDLLRPQDWGEIKPVLSVASGGLHPGHIPDLI
SIFGVDCVLQFGGGVHGHPRGTRAGASAVRAAVEAATSGQSFQEVARREKTLEEAIMHWG
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
ttgcgctacagtgatttcgtagaactcaactacactccttctccttctgactgtctggcc
tgcttctacgtggagccggcggagggggtggacatttacgaggctgccggggcggtagct
tcggagtcttctatcggcacctggaccgacgtggccaccatgaagcccaggatatgggag
gagttgcgggcgcgggtatatgccatagaaggaaacgtggtaaagattgcctatcctgct
gcccttttcgagccggggaacatcccccagtacttgagcagcatagccggaaacatcttc
ggtatgaaggcggtgaagaacttaaggcttttggacataagttttcctcccgagctcgta
tccgggtcgctgggaccggctttcggcgtccagggagtaagggagaccttaggaatttac
gggcggcccttggtgggtaccatcgtcaagcccaagctggggcttagcccccgggagcag
gccgaggtggtctacgaggcgctggtaggagggcttgatctagtcaaggacgacgagaac
ctgacctctcagcccttctcccccttcgaggagcgggtcaagcgaagcctggaggcctgc
gctcgggcagaggcggaggcaggggaaaagaaggtctacctgcccaacgtgacggcggag
acggaggagatgatccggcgggcggaactggtaaagcgggaaggcgggcgctacgtgatg
gtggacatagttacagccggcttttccggactcttaagcctgcgcaaggccaacctggga
cttataatccacgcccaccgcgccatgtacgccagctttgcccggaacaggcggcacggt
atatccatgctggtgctggccaaactggcccgcctggccggcgtggaccagctgcacatc
ggcaccgtggtggggaagatggagggggataaagaggacgtgctgcgctgccacgcggcg
ctgggcaacgcctcccccgtctccggcgatctcctccgcccccaggactggggcgagata
aagccggttttgtcggtggcttccggcgggctgcatcccgggcacataccggatctcatc
tccatctttggcgtggactgtgtgctgcagtttggtgggggagtgcacgggcacccccgg
ggtacccgagccggggccagcgccgtgcgggcggcggtggaggcggcgaccagcggtcag
agcttccaagaggtagcccggcgggagaaaaccttagaagaagccatcatgcattgggga
ggttga

DBGET integrated database retrieval system