KEGG   Ammonifex degensii: Adeg_2053Help
Entry
Adeg_2053         CDS       T00994                                 

Definition
(GenBank) extracellular solute-binding protein family 3
  KO
K10036  glutamine transport system substrate-binding protein
Organism
adg  Ammonifex degensii
Pathway
adg02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:adg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Adeg_2053
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:adg02000]
    Adeg_2053
Transporters [BR:adg02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamine transporter
    Adeg_2053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 OpuAC Phosphonate-bd DUF3834 PBP_like_2
Motif
Other DBs
NCBI-ProteinID: ACX53131
UniProt: C9RA02
LinkDB All DBs
Position
2047522..2048337
Genome map
AA seq 271 aa AA seqDB search
MKRFWSRLCIGLVLVTAIFLSGCGASSSKTTAESQKPKYVVATEASFAPFEFRDDKTGQI
TGFDIDLMKALAAIQGFDVEFKDMGFDGIIAAVKTGSVDMAISAISIDEERKKQVNFSLP
YYQSGLCVAVRADNQNIKTLKDLEGKKIAAQLGTTGAKFAKTIPGAKVIEFNTANDAFME
LINGGVDAFINDYPVTAYFIKQGHPEVKVVKDIHINSEFYGIAVPKNRPELLQKINEGLK
KLKENGQYAEIYRRWFGENPPDFLPGEPPAK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggttctggtcgaggctgtgcataggacttgtgctggtgaccgctatcttttta
tccggctgcggcgcttccagcagcaaaaccaccgccgaaagccaaaagcccaagtatgtg
gtagccaccgaggcttcctttgctccctttgagttccgcgacgacaagaccgggcagata
acgggctttgacatcgaccttatgaaggctctggcagctatccaaggctttgacgtggag
ttcaaagacatggggtttgacggcattatcgccgccgtgaagacgggaagcgtggacatg
gccatatcggccataagcattgacgaagagcgcaaaaagcaggttaacttctccctaccc
tactaccagtccgggctttgcgtggccgtgcgggcagacaaccagaatatcaagactctc
aaagacctcgaagggaagaaaatagcggcccagctcggcaccaccggggcaaaatttgcc
aagaccattccgggagccaaagtcatcgagtttaatacggccaacgacgccttcatggag
ctcatcaacgggggcgtggacgccttcatcaacgactacccggtgaccgcttacttcatc
aagcaaggtcacccagaggtaaaagtggtcaaggatatccatatcaacagcgaattctac
ggcatcgccgttcccaagaaccggcccgagctcttgcagaaaataaacgagggactgaag
aagctaaaagagaacggccagtatgcggaaatctaccgccgctggtttggggaaaatccc
ccggactttctccctggtgagcctccggccaagtaa

DBGET integrated database retrieval system