KEGG   Aeromonas dhakensis: CK627_00225
Entry
CK627_00225       CDS       T05186                                 

Definition
(GenBank) Holliday junction branch migration DNA helicase RuvB
  KO
K03551  holliday junction DNA helicase RuvB [EC:3.6.4.12]
Organism
adh  Aeromonas dhakensis
Pathway
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CK627_00225
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_00225
Enzymes [BR:adh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CK627_00225
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CK627_00225
    RecFOR pathway proteins
     CK627_00225
SSDB
Motif
Pfam: RuvB_N AAA_lid_4 RuvB_C AAA AAA_5 AAA_22 Mg_chelatase AAA_3 AAA_16 AAA_14 Rad17 AAA_18 NTPase_1 RNA_helicase Bac_DnaA TIP49 AAA_24 AAA_17 TsaE HTH_15 NB-ARC Sigma54_activ_2 AAA_28 IstB_IS21 ABC_tran
Other DBs
NCBI-ProteinID: ASX09332
LinkDB
Position
complement(33337..34347)
AA seq 336 aa
MIEADRLISAAGGREEEVIDRAIRPKLLADYTGQDPVCEQMEIFIAAARQRGEALDHLLI
FGPPGLGKTTLANIVANEMGVNIKTTSGPVLEKAGDLAALLTNLEPNDVLFIDEIHRLSP
VVEEVLYPAMEDYQLDIMIGEGPAARSIKLDLPPFTLIGATTRAGSLTSPLRDRFGIVQR
LEFYNVRDLTDIVARSARCLGLDMTEDGALEVARRSRGTPRIANRLLRRVRDFAQVKSDG
RIDGPIAARAMDMLDVDNEGFDFMDRKLLLAVIDKFLGGPVGLDNLAAAIGEEKDTIEDV
LEPYLIQQGFLQRTPRGRIATPRAYAHFGLQRPDEG
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgattgaagcggatcgcctcatttccgccgctggcgggcgtgaggaagaagtcatcgat
cgggccatccggcccaagctgctggccgattacaccggccaggatccggtctgcgaacag
atggagatcttcatcgcggcggcgcgccagcgcggcgaggcgctcgatcacctgttgatc
ttcggcccgcccgggcttggcaagaccacgctcgccaacatagtggccaacgagatgggg
gtcaacatcaagaccacctccggccccgtgctggagaaggccggcgatctggcggcgctg
ctcaccaacctcgagccgaacgacgtgctgttcatcgacgagatccaccgcctcagccct
gtggtggaggaggtgctctacccggcgatggaggattaccagctcgacatcatgatcggg
gaggggccggcggcgcgctccatcaagctcgacctgccccccttcaccctgatcggcgcg
acgacccgggccggctctctcaccagcccgctgcgggatcgcttcggtatcgtgcagcgc
ctcgagttctacaacgtcagggatctgaccgacatcgtcgcccgcagcgcccgctgcctc
gggctcgacatgacggaagacggcgcgctggaggtggcgcgtcgctcgcgcgggacgccg
cgaattgctaaccgtttgttgcgccgggtacgggattttgcccaggtgaaatccgacggc
cggattgacggacccatagcggcccgagccatggacatgctggacgtggataacgaaggg
ttcgacttcatggaccgcaagctattgttggctgtcatagacaagtttctgggggggccg
gtggggctcgacaacctggctgcggccatcggcgaggagaaggacaccatcgaagatgtg
ctcgaaccctatctgatccagcagggcttcctgcaacgtacacccagagggcggatcgcg
acaccaagagcttatgcgcattttggcctgcaacggccagatgaagggtaa

DBGET integrated database retrieval system