KEGG   Aeromonas dhakensis: CK627_00230
Entry
CK627_00230       CDS       T05186                                 

Definition
(GenBank) Holliday junction branch migration protein RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
adh  Aeromonas dhakensis
Pathway
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CK627_00230
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_00230
Enzymes [BR:adh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CK627_00230
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CK627_00230
    RecFOR pathway proteins
     CK627_00230
SSDB
Motif
Pfam: RuvA_N RuvA_C HHH_5 HHH IMS_HHH HHH_8 DUF2497 DUF3173 RHH_1
Other DBs
NCBI-ProteinID: ASX09333
LinkDB
Position
complement(34356..34970)
AA seq 204 aa
MIGRLRGVVIEKQPPEVLLEVGGVGYEVHMPMSCFYDLPEIGKEAVIHTHFVVREDAQLL
YGFNHKQERALFRELIKTNGVGPKLALAILSGMTATQFVLSVEREEISSLVKLPGVGKKT
AERLVVEMKDRLKGWVSHDLFSPAEITLPAKESALWAPDSSEEAASALVALGYKPQQASQ
IVSKVAVDGMSVEDIIREALRSLV
NT seq 615 nt   +upstreamnt  +downstreamnt
gtgattggtcgcttgagaggcgtagtcattgagaaacaaccccccgaggtattgctggag
gtcgggggcgtgggctatgaggtgcacatgcccatgagctgcttctatgatctgcccgag
atcggcaaggaagcggtcattcacacccatttcgtggtgcgggaagacgcccaactgctg
tacggcttcaatcacaagcaggagcgggcgctgtttcgcgagttgatcaagaccaacggg
gtcggccccaagctggcgctggccatcctctccggcatgaccgccacccagttcgtgctg
agtgtcgagcgcgaggagataagctccctggtcaagttgccaggggttggcaagaagact
gccgagcggctggtggtggagatgaaggacaggctcaaggggtgggtcagccacgatctc
ttctcgccggccgagatcaccctgcccgcgaaggagagtgccctgtgggcgccggattcg
agcgaagaggccgccagtgcgctggtagcactcggttacaagccgcagcaggccagccag
atcgtcagcaaggtggcggtggatggcatgtcggtggaagatatcatccgtgaagcgctg
cgcagcctggtgtga

DBGET integrated database retrieval system