KEGG   Aeromonas dhakensis: CK627_00725
Entry
CK627_00725       CDS       T05186                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
adh  Aeromonas dhakensis
Pathway
adh03030  DNA replication
adh03430  Mismatch repair
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CK627_00725
   03430 Mismatch repair
    CK627_00725
   03440 Homologous recombination
    CK627_00725
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:adh03032]
    CK627_00725
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_00725
Enzymes [BR:adh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CK627_00725
DNA replication proteins [BR:adh03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CK627_00725
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     CK627_00725
SSDB
Motif
Pfam: DNA_pol3_chi PP28
Other DBs
NCBI-ProteinID: ASX09422
LinkDB
Position
122912..123367
AA seq 151 aa
MSQVTFYLMSEQDDAQASAVERLACSLAAESWGACHLYLFCDDEAQALRLDELLWQLPPE
RFVPHQLQGESGQAPVEIGHQPPRRRYARLINLAKQTPLFAGHFAQVVDFVPTDETQKQQ
ARERYKHYRQAGHTLEMRDQPVLAAPDPAQP
NT seq 456 nt   +upstreamnt  +downstreamnt
atgagccaagtgaccttttacctgatgagcgaacaggatgacgcgcaggcctctgccgtc
gagcgactcgcctgcagccttgcggccgagtcgtggggggcgtgccacctctatctgttc
tgcgacgacgaagcgcaggccctgcgcctcgacgagctgttgtggcagctgccgccggag
cgcttcgtgccgcaccagttgcagggtgagagcggccaggcaccggtggagatcggtcac
cagccgccacggcggcgctacgcccgcctcatcaatctggccaaacagacacctttgttt
gcaggacacttcgctcaagtggtagattttgtccccactgacgaaacgcaaaagcagcaa
gcccgcgagcgctacaagcactatcgccaggcaggccacaccctcgagatgagggatcag
cccgtccttgccgcaccggatccggcgcagccctga

KEGG   Aeromonas dhakensis: CK627_03900
Entry
CK627_03900       CDS       T05186                                 

Definition
(GenBank) DNA polymerase III subunit beta
  KO
K02338  DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
adh  Aeromonas dhakensis
Pathway
adh03030  DNA replication
adh03430  Mismatch repair
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CK627_03900
   03430 Mismatch repair
    CK627_03900
   03440 Homologous recombination
    CK627_03900
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:adh03032]
    CK627_03900
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_03900
Enzymes [BR:adh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CK627_03900
DNA replication proteins [BR:adh03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CK627_03900
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     CK627_03900
SSDB
Motif
Pfam: DNA_pol3_beta DNA_pol3_beta_3 DNA_pol3_beta_2
Other DBs
NCBI-ProteinID: ASX09980
LinkDB
Position
complement(782719..783822)
AA seq 367 aa
MQLEISREALLRPLQLVSGALGGRPTLPILGNVLLDVSNGLLSLTGTDLEVEMIGQVYLN
SDSQDGRTTVPARKLLDICRGLPEGADIRLNTEGERLIIRSGRSRFNLSTLPATEYPNIE
DWESVLEFDIGQLELKKLIDATQFSMASQDVRYYLNGMLFESEGHGLRTVATDGHRLATC
RREVVSESLPDHQVILPRKGVLELVRLLEAEDKPVRLQIGRSNLRAALDGFIFTSKLVDG
RFPDWRRVIPRNSDKALIAGREDLRQAFARAAILSNEKFRGVRLNLQENLLRITANNPEQ
EEAEELLDVQYEAGEMEIGFNVSYVLDVLNTLKCDQIRISLSDSISSAIIEDFDSQDAQY
VVMPMRI
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgcagctcgaaattagccgtgaggccctgttacgtcctctgcaactggtgtccggtgcc
ctcggtggccggccgaccctgccgatcctcggcaacgtgctgcttgatgtcagcaacggt
ctgttgtcactgaccggtaccgacctcgaagtggagatgatcggtcaggtctatctcaac
agcgacagtcaggatggccgcaccacagtaccggcgcgcaagctgctggacatttgtcgc
ggtctgccggaaggggcggacattcgcctcaataccgaaggcgagcgcctgatcatccgc
tccggccgttcccgcttcaacctgtcgaccctgccggccaccgaatacccgaacatcgag
gattgggaatccgtgctcgagttcgacatcggccagctggagctgaaaaaactcatcgac
gcgacccagttctccatggcgagccaggacgtgcgctactacctgaacggcatgctgttc
gagagcgagggccacggcctgcgtaccgtggccaccgatggccaccggctggcgacctgc
cgccgcgaggtggtgagcgaatcgctgcccgatcatcaggtcatcctgccgcgcaagggc
gtgctggaactggtgcgtctgctggaagcggaagacaagccggtgcggctgcagatcggc
cgtagcaacctgcgcgccgccctcgacggcttcatcttcacctccaagctagtggatggc
cgcttcccggactggcgccgcgtcattccgcgcaacagcgacaaggccctgatcgctggc
cgtgaggatctgcgccaggcctttgcccgtgccgccatcctctccaacgagaaattccgt
ggggtgcgtctcaatctgcaggaaaacctgctgcgcatcaccgccaacaacccggaacag
gaagaagccgaagagctgcttgacgtacaatacgaagccggcgagatggagattggtttc
aacgtctcttatgtgctggacgtgctgaatacgttaaaatgtgaccaaatccggatcagc
ctgagcgattccatcagcagcgccattattgaggattttgacagtcaggatgctcagtat
gtggtaatgccgatgcggatctag

KEGG   Aeromonas dhakensis: CK627_07500
Entry
CK627_07500       CDS       T05186                                 

Definition
(GenBank) hypothetical protein
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
adh  Aeromonas dhakensis
Pathway
adh03030  DNA replication
adh03430  Mismatch repair
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CK627_07500
   03430 Mismatch repair
    CK627_07500
   03440 Homologous recombination
    CK627_07500
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:adh03032]
    CK627_07500
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_07500
Enzymes [BR:adh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CK627_07500
DNA replication proteins [BR:adh03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CK627_07500
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     CK627_07500
SSDB
Motif
Pfam: DNA_III_psi
Other DBs
NCBI-ProteinID: ASX10642
LinkDB
Position
complement(1517337..1517816)
AA seq 159 aa
MQDPVQLTTAREPVPEQPDQASARLRQHLLARMGIPSWQLRRPALLTGHQAAPAPANEPQ
ANLQEAAPAPAVPSEPPSGKLWILASRLPAPGLLADLCQLLGIGSDEVSLLSSLPAGHTP
PLLWLEAADPAWPEALICPLTPSPAQKRALWLQLKGRLG
NT seq 480 nt   +upstreamnt  +downstreamnt
atgcaagatccagtgcagctgaccacggcgcgggagcccgttcccgagcaacccgaccag
gcatccgctcgcctgcggcaacacctgctggcccggatgggcatccctagctggcaactg
cgccggccggccctgctgacgggccatcaggctgcgcccgcgccggccaatgagccccag
gcaaatctgcaggaggcggcccccgccccggccgtgccgagcgagccgccgagcggcaag
ctctggatcctggcgagccggctgcccgcccccggtctgctggcggatctctgccagctg
ctcggcatcggcagcgacgaggtcagcctgctgagcagcctgcctgccggccacaccccg
cccttgctctggctggaggcggccgatcccgcctggccagaggccctgatctgcccgctc
acccccagcccggcccagaaacgggctctgtggctgcagctcaaggggcgcctcggctga

KEGG   Aeromonas dhakensis: CK627_09480
Entry
CK627_09480       CDS       T05186                                 

Gene name
holA
Definition
(GenBank) DNA polymerase III subunit delta
  KO
K02340  DNA polymerase III subunit delta [EC:2.7.7.7]
Organism
adh  Aeromonas dhakensis
Pathway
adh03030  DNA replication
adh03430  Mismatch repair
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CK627_09480 (holA)
   03430 Mismatch repair
    CK627_09480 (holA)
   03440 Homologous recombination
    CK627_09480 (holA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:adh03032]
    CK627_09480 (holA)
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_09480 (holA)
Enzymes [BR:adh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CK627_09480 (holA)
DNA replication proteins [BR:adh03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CK627_09480 (holA)
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     CK627_09480 (holA)
SSDB
Motif
Pfam: DNA_pol3_delta DNA_pol3_delt_C DNA_pol3_gamma3
Other DBs
NCBI-ProteinID: ASX10996
LinkDB
Position
complement(1932934..1933965)
AA seq 343 aa
MRVYPEQFADHLKAGLKPCYLIFGDEPLLKLEAIDAVRQVARKQGFDERHSFVVEQGLDW
NQVYDACQAMSLFSARQIIELELPAKVDKELAARISEIGKQLHPDLLLVLSGNRLNQTQM
KAAWFDKLSQSGTYVPVNHPEPRFFPRWMSARFQRFGLKALPDAVNFMCHSYEGNLLAAS
QEIEKLTLLSPPQPISVAYLQETIIRHAHFTPFQLIDTLLEGKVNRAQRILLALRAEGTE
PGMLAWTLCRELEQLTELALAARAGQPLVEHFSRLRIWQSRQQLIQQALTRLPFAKLQQL
WQLMARLDDAQRRFDTEQAWLMLQTIALGFRDGTPLPLAGSDA
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgagagtctatcccgagcagtttgcggatcatctcaaggcagggctcaagccctgctat
ctcatttttggggacgagcctttgctcaagctcgaggccatcgacgccgtgcgccaggtg
gcgcgcaaacagggcttcgatgagcgccacagcttcgtggtggaacaggggctggactgg
aatcaggtctacgatgcctgccaggccatgagcctgttctcggcccgccagatcatcgag
ctggagctgccggccaaggtcgacaaggagttggccgcccgcatcagcgagatcggcaag
cagctccaccccgacctgctgctggtactgagcggcaatcgtctcaaccagacccagatg
aaggcagcctggttcgacaagctgagccagagcggcacctatgtgccggtcaaccacccc
gagccccgcttcttcccgcgctggatgagcgcccgctttcagcgcttcggcctcaaggcg
ctgccggatgcggtcaacttcatgtgccactcctacgagggcaacctgctggccgccagc
caggagatagagaagctgaccctgctctcgccgccccagcccatcagcgtcgcctatctg
caggagaccatcatccgccacgcccacttcaccccgttccagctcatcgacaccctgctg
gaagggaaggtgaaccgggcccagcgcatcctgctggccctgcgcgccgagggcaccgag
ccaggcatgctggcctggaccctgtgccgcgagctggagcagctcaccgagctggcactg
gcggccagggccggtcagcccctggtggagcatttcagccgcctgcgcatctggcagagc
cgccagcagcttattcagcaggcgctgacccggctccccttcgccaaactgcagcagttg
tggcagctgatggcccgcctcgacgacgcccagcgtcgcttcgataccgagcaggcctgg
ctgatgctgcaaaccatcgccctcggttttcgcgatggcacccccttgccgctggcggga
tctgacgcatga

KEGG   Aeromonas dhakensis: CK627_13965
Entry
CK627_13965       CDS       T05186                                 

Definition
(GenBank) DNA polymerase III subunit epsilon
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
adh  Aeromonas dhakensis
Pathway
adh03030  DNA replication
adh03430  Mismatch repair
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CK627_13965
   03430 Mismatch repair
    CK627_13965
   03440 Homologous recombination
    CK627_13965
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:adh03032]
    CK627_13965
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_13965
Enzymes [BR:adh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CK627_13965
DNA replication proteins [BR:adh03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CK627_13965
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     CK627_13965
SSDB
Motif
Pfam: RNase_T DUF5051
Other DBs
NCBI-ProteinID: ASX11808
LinkDB
Position
complement(2982547..2983173)
AA seq 208 aa
MLSRLRRRWHGRRVKDPAFAPLYADPPADEWVALDFETTSLDPAQAEIVAIGAVRIQGNR
VLTGEALSIRVQAPASLSEHSVVIHGLRHQDLQQGMTLEAALRLLLAFIGPRELVGYHIA
YDLRILNLACQRCWGLTLAQRGIEVSRLYHDHLYRRYPDAAIDLHLAAISSHLGLPALPA
HDALSDAITAALIFLRLTRGGPLAYPKV
NT seq 627 nt   +upstreamnt  +downstreamnt
atgttgagccgcctgcgccgtcgttggcatggccgccgcgttaaagacccggcatttgcc
ccgctctatgccgacccgcccgccgacgagtgggtggccctcgacttcgagaccaccagc
ctggatcccgcccaggccgagatcgtcgccatcggcgcggtgcgcatccagggcaaccgg
gtgctgaccggcgaggcgctgtccatccgggtgcaagcgccggccagcctgagcgaacat
tcggtggtgatccacggtctgcgccatcaggatctgcaacagggcatgacgctggaggcc
gcgctgcgcctgctgctcgcctttatcggcccgcgcgaactggtggggtatcacatcgcc
tacgacctgcggatcctcaatctcgcctgccagcgatgctggggactgaccctggcgcag
cggggaatagaggtgagccggctctaccacgatcacctctatcgccgctatcccgatgcc
gccatcgacctgcatctggccgccatcagcagccacctgggcctgccggccctgcccgcc
cacgacgccctgagcgatgccatcaccgccgccctcatcttcttgcgcctcacccggggc
gggccactggcttatcccaaagtctaa

KEGG   Aeromonas dhakensis: CK627_14830
Entry
CK627_14830       CDS       T05186                                 

Definition
(GenBank) DNA polymerase III subunit gamma/tau
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
adh  Aeromonas dhakensis
Pathway
adh03030  DNA replication
adh03430  Mismatch repair
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CK627_14830
   03430 Mismatch repair
    CK627_14830
   03440 Homologous recombination
    CK627_14830
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:adh03032]
    CK627_14830
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_14830
Enzymes [BR:adh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CK627_14830
DNA replication proteins [BR:adh03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CK627_14830
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     CK627_14830
SSDB
Motif
Pfam: DNA_pol3_delta2 DNA_pol3_tau_5 DNA_pol3_gamma3 AAA RuvB_N AAA_5 AAA_18 AAA_22 ResIII AAA_14 AAA_30 AAA_16 Rad17 AAA_19 TsaE TniB VirE SKI Mg_chelatase DUF815 AAA_24 PIF1 ABC_tran ERAP1_C DNA_pol3_delta Herpes_Helicase
Other DBs
NCBI-ProteinID: ASX11961
LinkDB
Position
3175696..3178242
AA seq 848 aa
MSYQVLARKWRPHTFEQVVGQHHVLTALTNALDQGRLHHAYLLSGTRGVGKTTIARILAK
SLNCEQGISSHPCGVCDTCREIDQGNFVDLLEIDAASRTKVEDTRELLDNVQYRPARGRF
KVYLIDEVHMLSRHSFNALLKTLEEPPPYVKFLLATTDPQKLPITILSRCLQFHLKSLDQ
TQIAKQLEWVLDQEGQPFEPRALLALAKAADGSMRDALSLTDQALAHGNGSVRTDSVLAM
LGTLDHRHLHQLLEAVLRQDAPATMAKITEIATLGPDFDQLHAELEGLLHRIAMAQLLPA
TVQEQGADADALLQLAQAMSPEEVQLCYQIVLGGRKDLPWAPDGRTALEMTCLRMLAFSP
RREVLHPASLTALPPALGGLPAAGARSPAPALGKPEGVEPPPATDMMPQAPSADAAISPA
PVTSSASVEHQGAQEAGQAAQPHSQLADMAEPEGGAALDPLFAEQAELLREAEQMGYEAA
SEPIAPTAQPAAAQPASSVQGAVPTNVADEVADSGEGSVSSTVASMQSLLGKRNLLRSRL
RGEPSGNAAPARATPVKPMAAAKPAPMAPAAAMPPSTPHSPSAPRVQAAAQAAQSGYDEL
PPLDAYEESGSDYEEYLSQGFNDAFASAPLPERTTQVMQPAPAARPQADDLPPWDLDGSA
GRQTVAAPSAPVAVATPPEATISEPAASVMETIDWNELESDNQPQGSEEAARLIPSSLLA
NCGDHWAELIARTGVGGRLRQLAINSVMEQQGDKVLLTLKPEQRHLVSDRARADLAEIIG
PELGLAVQVDVTLGVVPERETPLEIEHRLYLGVREQVTRDLEQDPNVQFLQQRFGAMLHH
DSIEPLSN
NT seq 2547 nt   +upstreamnt  +downstreamnt
atgagctatcaggttctggcgcgtaaatggcgcccccatacgtttgaacaagtggtaggc
cagcatcatgtgctgaccgccttgaccaacgccctggatcagggacggctgcatcacgcc
tatctgctgagcggtactcgcggggtcggcaagaccaccattgcgcgcatcctggccaag
agcctcaactgcgagcaggggatcagcagtcatccgtgcggcgtgtgcgacacctgccgc
gagatcgatcagggcaacttcgtcgatctgctggagatagacgcggcgtcacgcaccaag
gtggaagatacccgcgagctgctcgacaacgtgcagtaccgaccggcccgtggccgtttc
aaggtctatctcatcgacgaagtgcacatgttgtcgcgccacagcttcaacgcgctgctg
aaaaccctggaagagccgcccccctatgtgaagttcctgctggccaccacggatccgcaa
aagctgcccatcaccatcctctcgcgctgcctgcagtttcatctgaagagtctggatcag
acccagatcgccaagcagctcgaatgggtgctggatcaggagggacaacccttcgagccg
cgcgccctgctggccctggccaaggcggcggacggcagcatgcgcgatgccctgagcctg
accgatcaggcgctggcccacggcaatggcagcgtgcgcaccgacagcgtgctggccatg
ctggggaccctggatcaccgccatctgcatcaactgctggaagctgtgctgcgccaggat
gcacccgccaccatggccaagatcaccgagatagcgaccctgggccccgactttgatcag
ctccatgccgagctggaagggctgctccatcgcatcgccatggcgcagctgttgccggcc
accgtgcaggagcagggggcggatgccgatgccctgctgcagctggcccaggccatgagc
ccggaagaggtgcagctctgctatcagatcgtgctggggggccgcaaggatctgccctgg
gcccccgatggccgcaccgcactggagatgacctgcctgcggatgctggccttctcgccc
cggcgcgaggtgctgcaccccgccagcttgacggcgctgcctccggcactcggtggccta
cccgccgcaggtgcgaggagcccagcccccgccttgggaaagcccgagggggttgagcca
cccccggccaccgacatgatgccgcaggctccgtcagccgacgccgcgatttcgcctgcg
ccggttacttcttctgcatcggtcgagcaccaaggggcgcaggaggccggacaggccgcc
cagcctcactcacagttggctgacatggcggagccggaaggcggcgccgcgctggatccg
ctctttgccgagcaggcggagctgctgcgtgaggccgagcagatgggttatgaagccgcg
tccgaacctattgcgcccacggctcagcctgccgctgcccagcccgcgtcctccgtacaa
ggcgccgtaccaacgaatgtggctgacgaagtggctgacagcggggaggggagtgtctct
tcaacggtggccagcatgcaaagtctgctgggcaagcgcaatctgctgcgaagccgcctg
cgcggcgagccgagcggcaatgcggcgccagcccgggcgacgccggtcaagccgatggcg
gccgccaaaccggcaccgatggcaccggctgcggccatgccgccctcgacgccccactcc
ccgagtgccccccgggtgcaggcagctgcccaggcggcccagtcaggttacgatgaattg
ccgccgctcgatgcctatgaagagagcggcagcgactacgaagagtatttgagtcagggt
ttcaacgatgcgttcgccagcgcccccttgccggagcgaaccacccaggtgatgcagcca
gcgcccgccgctcgtccccaggcggatgatctgccgccctgggatctggatggcagtgcc
ggccggcagacggtcgctgcgccgagtgcgccggtcgccgttgcaacgccccctgaggcg
accatcagcgagcctgccgcctcggtcatggaaaccatcgactggaacgagctggagagc
gacaaccagccgcaagggagtgaggaggcggccagattgatcccctcttcgctgctggcc
aattgcggcgaccattgggccgaactgattgcccgcaccggtgtgggtggccgcctgcgc
cagctggccatcaattcagtgatggagcagcagggtgacaaggtgctgctgaccctcaaa
cccgagcagcgccatctggtgagcgacagggcgcgcgccgatctggccgagatcatcggc
cccgaactggggctggcggtacaggtggacgtcaccctgggcgtggtgccagagcgggaa
accccgctcgagattgagcaccgcctctatctcggggtgcgggagcaggtcacccgggat
ctggagcaggatcccaacgtgcaattcttgcaacagcggtttggcgccatgctgcaccac
gacagcatagagccgctgagcaactga

KEGG   Aeromonas dhakensis: CK627_15050
Entry
CK627_15050       CDS       T05186                                 

Gene name
holB
Definition
(GenBank) DNA polymerase III subunit delta'
  KO
K02341  DNA polymerase III subunit delta' [EC:2.7.7.7]
Organism
adh  Aeromonas dhakensis
Pathway
adh03030  DNA replication
adh03430  Mismatch repair
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CK627_15050 (holB)
   03430 Mismatch repair
    CK627_15050 (holB)
   03440 Homologous recombination
    CK627_15050 (holB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:adh03032]
    CK627_15050 (holB)
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_15050 (holB)
Enzymes [BR:adh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CK627_15050 (holB)
DNA replication proteins [BR:adh03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CK627_15050 (holB)
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     CK627_15050 (holB)
SSDB
Motif
Pfam: DNA_pol3_delta2 DNApol3-delta_C AAA AAA_5 Mg_chelatase QueC
Other DBs
NCBI-ProteinID: ASX12002
LinkDB
Position
3232555..3233502
AA seq 315 aa
MYPWLIPDWHALSQTAAAGRLGHAWLLLGDPGLGKEQLAQQLARLHLCHQPDRGEPCGHC
HSCQLFEKGHHPDLGTLTTEGKTIGVEAIREICARLQNSAQLGRGKVVIIPDAERMTESA
ANALLKTLEEPAGDSLLLLIASQVSRLLPTILSRCHKHVCQLPAEGETLAWLAEQGHQAT
QAQVRICQGAPLRVLDYLTQQQDTDRRDLLESFLALSQTPTRTNHVCSLLASDTQVRLHW
VQLFLCDALKTQAGCGPHQLAMPDLAALSQQLAERHSSEKLLEAEQQLVGLKAACQPGQL
SNPTIHLMNWLTRWL
NT seq 948 nt   +upstreamnt  +downstreamnt
atgtatccctggttgatcccggactggcatgccttgagtcagactgccgccgccggccgg
ctggggcacgcctggctgctgctgggtgatcccggtcttggcaaggagcaacttgcacag
cagctggcccgcctgcacctgtgccatcagcctgatcggggcgagccttgcggtcattgc
cactcctgtcagctgtttgaaaagggtcatcacccggatctgggcaccctcaccactgag
ggcaagaccataggggtcgaggccatccgcgagatctgtgcacgtctgcagaattcggcc
cagcttggccgaggcaaggtagttatcatcccggatgcagagcgcatgaccgaatcggcc
gccaacgccctgctcaaaaccctggaggagccggctggcgacagcttgctgctgctgatc
gcctcccaggtttcccgcctgctgcccaccattctcagccgttgccacaagcatgtctgc
cagttgccggcggaaggggagactctggcctggctcgccgagcagggtcatcaggccacc
caggctcaggtgcggatctgccagggggctccgctgcgagtgctggattacttgacgcag
cagcaggacacggatcgccgtgatctgcttgagagttttctcgcactctcgcaaacaccc
acccggaccaaccatgtgtgcagcctgctggcaagcgatacccaggtcagactgcactgg
gtgcagctgttcttgtgcgatgcgctcaagacgcaggccggttgtggccctcaccagctg
gccatgccggatctggccgcgctcagtcaacaactggcggaacgtcactccagtgaaaag
ctgctggaggcggagcagcagctcgttgggctcaaggcggcctgccagcccgggcagctc
tccaaccccaccattcatttgatgaactggctcactcgctggttatag

KEGG   Aeromonas dhakensis: CK627_18230
Entry
CK627_18230       CDS       T05186                                 

Definition
(GenBank) DNA polymerase III subunit epsilon
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
adh  Aeromonas dhakensis
Pathway
adh03030  DNA replication
adh03430  Mismatch repair
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CK627_18230
   03430 Mismatch repair
    CK627_18230
   03440 Homologous recombination
    CK627_18230
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:adh03032]
    CK627_18230
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_18230
Enzymes [BR:adh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CK627_18230
DNA replication proteins [BR:adh03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CK627_18230
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     CK627_18230
SSDB
Motif
Pfam: RNase_T DUF5051 DNA_pol_A_exo1
Other DBs
NCBI-ProteinID: ASX12584
LinkDB
Position
complement(3930717..3931451)
AA seq 244 aa
MSTPQLNRQIILDTETTGMNTAGGPVYLGHRIIEIGCVEVINRKLTGNHFHVYIKPDRLV
DPEAIQVHGITDEFLRDKPSFSQIADEFIEFIRGAELIAHNAPFDVSFMDYEFSKLGLNF
KTADICGITDTLAMARDLFPGKRNNLDVLCDRYGIDNSHRTLHGALLDAEILADVYLLMT
GGQTKLNLATESNENESNQDTSIRRLESNRPPLKVIRASADVEAVHEARLDLVQKKGGAC
LWRQ
NT seq 735 nt   +upstreamnt  +downstreamnt
atgagcacaccccaactgaatcgccagatcattctggatactgaaaccactggtatgaac
acggccggtggccccgtctatctgggacaccggatcatcgagatcggctgtgtggaggtg
atcaaccgcaagctgaccgggaaccacttccacgtctacatcaagccggaccggctggtg
gacccggaagccatccaggtgcacggcattaccgacgagtttttgcgtgacaagccgtcg
ttcagccagattgccgacgagttcattgagtttatccgcggcgccgagctgattgcccac
aacgcgccgtttgacgtgagcttcatggactatgagttcagcaagctcggcctcaatttc
aagaccgccgacatctgcggcatcacggataccctggcgatggcgcgggacctgttcccg
ggcaagcgcaacaacctggacgtgctgtgcgatcgctacggtatcgacaactcgcaccgt
accctgcacggggccttgctcgatgcggagatcctggcagacgtctacctgttgatgacg
ggtggccagaccaaactgaacctggccaccgagagcaacgagaatgaaagcaaccaggac
accagtatccggcggctggagagcaaccgtccaccgctcaaggtgatccgggccagtgcc
gacgttgaggcggtacacgaggcgcggctggatctggtgcagaagaagggaggagcctgc
ctgtggcggcaatga

KEGG   Aeromonas dhakensis: CK627_20195
Entry
CK627_20195       CDS       T05186                                 

Definition
(GenBank) DNA polymerase III subunit alpha
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Organism
adh  Aeromonas dhakensis
Pathway
adh03030  DNA replication
adh03430  Mismatch repair
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CK627_20195
   03430 Mismatch repair
    CK627_20195
   03440 Homologous recombination
    CK627_20195
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:adh03032]
    CK627_20195
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_20195
Enzymes [BR:adh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CK627_20195
DNA replication proteins [BR:adh03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CK627_20195
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     CK627_20195
SSDB
Motif
Pfam: DNA_pol3_alpha DNA_pol3_finger PHP HHH_6 tRNA_anti-codon
Other DBs
NCBI-ProteinID: ASX13560
LinkDB
Position
complement(4379023..4382502)
AA seq 1159 aa
MADPRFIHLRVHTDFSMVDGLQKINPIVGAAAADNMPALALTDQMNMCGLVRFYGAAHGK
GIKPLVGADFWVQSSELGDEQFRLTLLAMDNDGYQNITLLISRGYQRGHVQGRPVIDKEW
LVEHAKGVIVLSGGREGDVGKFLLKGNRQMTEQCVAFYQTHFPDAYYLELLRTGRPDEEV
YLHMAVNLASEFALPVVATNEVVFLTADDFDAHEIRVAIHDGYTLMDKRRPRRYSPQQYL
RSQDEMCELFADIPEALENTVEIAKRCNVTVRLGEYFLPNFPTGDMTTEDFLVAKSKEGL
EERLEFLFPDPAVRAERRPEYDERLDIELKVINQMGFPGYFLIVMEFIQWSKDNGIPVGP
GRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSMPDFDVDFCMDRRDEVIEHVSE
MYGRDAVSQIITFGSMAAKAVVRDVGRVLGHAYGFVDRISKLIPPDPGMTLAKAFEAEPK
LPELYEQDEEVKDLIDMARRLEGVVRNAGKHAGGVVIAPTKITDFAPLYCDDEGHHPVTQ
FDKNDVEYAGLVKFDFLGLRTLTIIDWALGMINPRLAKEGKPPVDIAAIPIDDKRSFDLL
QRYETTAVFQLESRGMKDLIKRLQPDCFEDMIALVALFRPGPLQSGMVDNFIDRKHGNEA
ISYPDEKWQHESLQPILEPTYGIILYQEQVMQIAQTLAGYTLGGADMLRRAMGKKKPEEM
AKQRAGFEEGAIKNGVDGELAMKIFDLVEKFAGYGFNKSHSAAYALVSYQTLWLKTHFPA
EFMAAVMTADMDNTDKIVTLVDECQRMGLTVIPPDVNTGRYRFSVNEDGHIVYGIGAVKG
VGEGPIDAILEARDRDGPFRDLFDFCNRVDIKKLNKRVMEKLILSGAMDRLGPHRAALMA
TLEEAMRAAEQHAKAQAVGQVDMFGVLTEEIDDVKKAFANVPHWPDKVWLEGERETLGLY
LTGHPINQYSGELRRYTSGRLCDLHPTSRDTVTTAAGLVIAARSMVTKRGNKMGIFTLDD
RSGRLDVTLFSEALEKYEELMQKDRILVVSGQVSFDDFSGGLKMSARELLDINDARERFA
RAIRISLDEQRIDDRFFPRLCEILEPARAGVCPVQVNYRRPGSRVRLTLGTEWRVTPTDQ
LIDDLRVLLGRERVELVFD
NT seq 3480 nt   +upstreamnt  +downstreamnt
atggctgacccccgtttcattcacctgcgggtgcataccgacttttccatggtggatggt
ctgcagaagatcaaccccatcgtcggggccgcggcggccgacaacatgccggcgctggcc
ctgaccgaccagatgaacatgtgcggcctggtgcgcttctatggcgccgcccacggcaag
gggatcaagcctctggtcggtgccgacttctgggtgcagagcagtgaacttggcgacgag
cagtttcgcctcactctgctcgccatggacaacgacggctaccagaacatcaccctgctc
atctcccgcggctatcagcgcggccatgtgcaggggcggccggtcatcgacaaggagtgg
ctggtcgagcacgccaagggggtgatcgtgctctccggcgggcgcgagggggacgtgggc
aagttcctgctcaagggcaaccgccagatgaccgagcagtgcgtcgccttctaccagacc
cacttccctgacgcctactatctggagctgctgcgtaccggtcgccccgacgaggaggtc
tacctgcacatggcggtgaacctcgcgagcgagttcgcgctgccggtggtggccaccaac
gaggtggtgttcctcaccgccgatgacttcgacgcccacgagatccgggtggccatccac
gacggctataccctgatggacaagcgccggccgcgccgctacagcccgcagcagtacctg
cgcagtcaggacgaaatgtgcgagctgttcgccgacatcccggaggcgctggagaacacg
gtggagatcgccaagcgctgcaacgtgacggtgcgtctgggtgaatacttcctgcccaac
ttccccaccggcgacatgaccaccgaagacttcctggtggccaagtcgaaagaggggctg
gaggagcggctcgagtttctgttcccggatccggcggtgcgggccgagcgtcgtcccgag
tatgacgagcgcctcgacatcgagctgaaagtgatcaaccagatgggcttcccgggttac
ttcctcatcgtgatggagtttatccagtggtccaaggacaacggcatcccggtcggtccg
ggccggggctcgggtgcaggttcgctcgttgcctacgccctcaagatcaccgacctggat
ccactcgaatttgacctgctgttcgaacgtttcctgaaccccgagcgggtctccatgccc
gacttcgacgtcgacttctgcatggaccgacgggacgaggtgatcgagcacgtctccgag
atgtacggccgggatgctgtgtcccagatcatcaccttcggcagcatggcggccaaggcg
gtggtacgggacgtgggccgggtgctgggccacgcctacggtttcgtcgatcgcatctcc
aagctgatcccgccggatcccggcatgaccctggccaaggcgttcgaggccgagcccaag
ctgcccgagctctacgagcaggacgaggaggtcaaagacctcatcgacatggcgcgccgg
ctggaaggggtggtgcgcaacgccggcaaacacgccggtggcgtggtgatcgcgcccacc
aagatcaccgactttgcaccgctctactgcgatgacgagggccatcacccggtcacccag
ttcgacaagaatgacgtggaatacgccggcctggtgaagttcgacttcctgggtctgcgc
acgctcaccatcatcgactgggcgctcggcatgatcaacccgcgccttgccaaagagggc
aagccgccggtcgacatcgccgccatccccatcgacgacaagcgctcgttcgacctgctg
cagcgctacgagaccaccgcggtattccagctcgaatcccgcggcatgaaggatctcatc
aagcggctgcagccggactgcttcgaagacatgatcgctctggtggccctgttccggccg
ggcccgctccagtcaggcatggtggacaacttcatcgaccgcaaacacggcaatgaagcc
atctcctatccggacgagaagtggcagcacgagagtctgcaacccatcctggagcccacc
tacggcatcatcctctaccaggagcaggtgatgcagatcgcccagaccctggccgggtac
accctggggggcgcggatatgctgcgccgggccatgggcaagaaaaagcccgaggagatg
gccaagcagcgggccggttttgaagagggagccatcaagaacggcgtcgacggcgagctg
gcgatgaagatcttcgacctggtggagaagttcgcgggctacggcttcaacaaatcgcac
tccgccgcctatgcgctggtctcctaccagaccctctggctcaagacccacttcccggcc
gagttcatggcggcggtcatgaccgcagacatggacaacaccgacaagatagtgaccctg
gtggacgagtgtcagcggatggggctgacggtgatcccgccggacgtcaacaccggtcgc
taccgcttcagcgtcaacgaggacggtcatatcgtctacggcatcggcgcggtgaagggg
gtgggggaaggtcccatcgatgcgatcctggaagcacgggatcgggatggcccgttccgc
gacctgttcgacttctgcaaccgggtcgacatcaagaagctcaacaagcgggtgatggag
aagcttatcctctccggcgccatggaccggctcggccctcaccgcgccgccctgatggcg
accctggaggaggcgatgcgcgccgccgagcagcacgccaaggcccaggcggtggggcag
gtcgacatgttcggcgtgctcaccgaggagatagacgacgtcaagaaggcgttcgccaac
gtgccgcactggcccgacaaggtgtggctggaaggggagcgcgagaccctcgggctctac
ctgaccggtcaccccatcaaccagtacagcggcgaattacgtcgttacacctcgggtcgc
ctgtgcgatctgcatcccacctcccgcgataccgtgaccacggcggctgggctggtgatc
gcggcgcgcagcatggtgaccaagcgcggcaacaagatggggatcttcaccctggacgac
cgttccggtcgcctcgatgtgaccctgttcagtgaagcgctggaaaaatatgaagagttg
atgcaaaaagaccgtattttggtggtttctggacaggtcagctttgatgacttctccggt
ggccttaaaatgtcggcccgtgaattactggatatcaacgatgcgagagagcgttttgcc
agggcaatccgcatctctctcgatgaacagcgaatcgatgatcgctttttcccgcgtttg
tgcgagattttggagcccgcccgtgccggagtctgtccggttcaggtaaactatcgtcgc
cccggctcccgggtgcgattgacgctcggcaccgagtggcgggtgacgcccaccgatcaa
ctgatagatgacttgcgcgtcctgctgggacgagagcgggttgaattggtttttgattag

DBGET integrated database retrieval system