KEGG   Aeromonas dhakensis: CK627_00800
Entry
CK627_00800       CDS       T05186                                 

Gene name
recA
Definition
(GenBank) recombinase RecA
  KO
K03553  recombination protein RecA
Organism
adh  Aeromonas dhakensis
Pathway
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CK627_00800 (recA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_00800 (recA)
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CK627_00800 (recA)
    RecFOR pathway proteins
     CK627_00800 (recA)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    CK627_00800 (recA)
SSDB
Motif
Pfam: RecA Rad51 ATPase ATPase_2 AAA_24 AAA AAA_35 MobB AAA_25 AAA_14 TK AAA_16 CobU AAA_22 CLP1_P PAXNEB
Other DBs
NCBI-ProteinID: ASX09431
LinkDB
Position
complement(135850..136914)
AA seq 354 aa
MDQNKQKALAAALGQIEKQFGKGSIMRLGDSKTMDIEAISTGSLSLDVALGIGGLPCGRI
VEIYGPESSGKTTLTLQVIAEAQKKGKTCAFVDAEHALDPIYAAKLGVNVDDLLISQPDT
GEQALEICDMLVRSNAVDVIIVDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKLTAN
IKNANCLCIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAIKEGDEVVGNE
TRVKVVKNKVAPPFKQAEFQIFYGAGISKEGELVDLGVKHKLIDKAGAWYSYNGEKIGQG
KANVMKLFAENKALAGEVEAKLRELLLSGAAPVEEKPSAAEYDEFEAENEQEFE
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggatcagaacaaacagaaggcactggcggctgcgctgggtcagattgaaaagcagttc
ggcaaaggttccatcatgcgtctgggcgacagcaagaccatggatatcgaagccatctcc
accggctccctctctctggacgttgcgctggggatcggtggtctgccgtgcggtcgtatc
gtcgagatctacggcccggaatcttccggtaaaaccacgctgaccctgcaggtgatcgcc
gaagcccagaagaagggcaagacctgtgccttcgtcgatgcggaacacgcactggatccc
atctatgccgccaagctgggcgtcaacgtcgacgacctgctgatctcccagccggacacc
ggtgaacaggcgctggagatctgcgacatgctggtgcgctccaatgcagttgacgtcatc
atcgtcgactccgtggcggctctgaccccgaaagcggaaatcgaaggcgaaatgggtgac
tcccacgtcggcctgcaggctcgtctgatgtcccaggcgctgcgcaagctgaccgccaac
atcaagaacgccaactgcctgtgcatcttcatcaaccagatccggatgaaaattggcgtc
atgttcggcagcccggagaccactaccggtggtaacgcgctcaagttctacgcttccgtg
cgtctggatatccgccgtaccggcgccatcaaggaaggtgacgaagtggtcggtaacgag
acccgcgtcaaggtagtgaagaacaaggtagcccctcccttcaagcaggccgaattccag
atcttctacggtgccggcatctccaaagagggcgagctggtggatctgggtgtcaagcac
aagctgatcgacaaggccggtgcctggtacagctacaacggcgagaagatcggtcagggc
aaggccaacgtcatgaagctgttcgccgagaacaaggcgctggctggcgaagtggaagcc
aaactgcgcgagttgctgctctccggtgccgcgccggtggaggagaagccctccgctgcc
gagtacgacgagtttgaagccgaaaacgaacaagagttcgaataa

DBGET integrated database retrieval system