KEGG   Aeromonas dhakensis: CK627_02030
Entry
CK627_02030       CDS       T05186                                 

Definition
(GenBank) single-stranded DNA-binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
adh  Aeromonas dhakensis
Pathway
adh03030  DNA replication
adh03430  Mismatch repair
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CK627_02030
   03430 Mismatch repair
    CK627_02030
   03440 Homologous recombination
    CK627_02030
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:adh03032]
    CK627_02030
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_02030
   03029 Mitochondrial biogenesis [BR:adh03029]
    CK627_02030
DNA replication proteins [BR:adh03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    CK627_02030
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     CK627_02030
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    CK627_02030
Mitochondrial biogenesis [BR:adh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    CK627_02030
SSDB
Motif
Pfam: SSB Med15
Other DBs
NCBI-ProteinID: ASX09646
LinkDB
Position
377161..377736
AA seq 191 aa
MASRGINKVILIGNLGQDPEVRYMPSGGAVTNITLATSDTWRDKQTGEQKERTEWHRVVF
MGKLAEVAGEYLKKGSQVYVEGKLQTRKWQDQSGQERYTTEVLVDGFSGVMQMLGGRPQG
AGQGMGGQSQGNWGQPQQGMQSQQPMNQSRPAPQQNMQQQQGGYSRPAQQPQSAPPVYNE
PPMDFDDDIPF
NT seq 576 nt   +upstreamnt  +downstreamnt
atggccagtcgaggcatcaacaaagtcattctgatcggtaacctggggcaagacccggaa
gtgcgctacatgccgagcggcggtgccgtgaccaacatcaccctggccacctccgacacc
tggcgcgacaagcagaccggtgagcagaaagagcgtaccgagtggcaccgcgtcgtcttc
atgggcaagctggccgaagtggcgggcgagtacctgaagaagggttcccaggtctatgtg
gaaggcaagctgcagacccgcaagtggcaggatcagagcggccaggagcgttacaccacc
gaggtgctggtcgatggtttcagcggcgtgatgcagatgctgggtggccgtccgcaaggc
gccggtcagggcatgggcggtcagtcccagggcaactggggtcagccgcaacagggcatg
cagtcccaacagccgatgaaccagtcccgcccggctccgcagcagaacatgcagcaacag
cagggcggttatagccgtccggcccagcagccgcagtccgctccgccggtatacaacgag
ccgccgatggatttcgacgacgacatcccgttctaa

DBGET integrated database retrieval system