KEGG   Aeromonas dhakensis: CK627_02130
Entry
CK627_02130       CDS       T05186                                 

Gene name
recB
Definition
(GenBank) exodeoxyribonuclease V subunit beta
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
adh  Aeromonas dhakensis
Pathway
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CK627_02130 (recB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_02130 (recB)
Enzymes [BR:adh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CK627_02130 (recB)
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CK627_02130 (recB)
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1 AAA_11
Other DBs
NCBI-ProteinID: ASX09662
LinkDB
Position
complement(397021..400626)
AA seq 1201 aa
MANPLNTLRFPLHGERLIEASAGTGKTYTIAGLYLRLLLGHGPLIEEGADAGQASAHERP
LSVTEILVVTFTEAATAELRGRIRDRIHEARLAFMRGHSGDALLAQLLEEVEDHELAARR
LLAAERQMDEAAVFTIHGFCQRMLKQNAFESGALFETEFLTDDSQLRLQAVSDYWRAEFY
LVDKTLASAVRALWPSPAALLREMNGWLDNSELEMRPPVGDETLAARHQVAMARIEAVKA
AWLAQVDEIRRQTDGHISRYTGKNYEGWLAKIADWAQDETSGYAIPKELERFGQTVLEEN
LKKGGAVPTLPLFSEIDALLASRPGIRDLILQRAAVVVRSRMHASKRQAHQLSFDDLLKD
LDGALGSSLGERLCDRIRATYRVAMIDEFQDTDPQQYRIFHRLYGGHQDTALLMIGDPKQ
AIYGFRGADIFTYIQARRNVSAHYTLGRNWRSSGALVAAVNGLFERAKDPFIYEADIPFL
PVEAQGKSKALRLDGETAPVLHCWQLTGQPTFNRGDYQSRMARATAAEIHRLLSLAREGK
ALIGSEPVKAGDIAVLVRTGAEGKLVQQELARLAIASVYLSNRESVLEQVEAREILLILH
ACQNPSEERSLRAALATGLFDLDAKALDELASDERAWENAVQEFMEYRKVWHKRGVLAML
RALLHRRNLASSLLASPYGERRLTNFLHLGELLQQVSSELDGEYALLRWLGEAVNRQSGQ
DAEQILRLESERKLVQIVTIHKSKGLEYPLVFLPFICSHRSADTPLYHEADEAGNRTILD
LTGAEDSLAEADKERLAEDLRLLYVALTRGVYATWLGLAPVRSGNGKSEKTDLHQTAIGY
LLQKGEEGDAATLATALSALAEDLPGVAVGEPSLTRPAPLPAEEEQLGEPKVRRFGGTLE
RDWWISSYSGLAAQGHGHSKGVLANPGFDDEVVTEAAALAAEEPVQAPQPSIFTFPKGAR
PGTLLHSLFETIDFESAAGEPLAQHIATLLAQDGFDESWAQVLQQQVEAVLDTPLETGFG
EPVRLRDLAPERKQVELEFFLPMGRVTAPALTALCQQHDPLSRGNKPLSFATVQGMLKGF
IDLVFEWQGRWYLLDYKSNHLGMSPADYSRPALEQAMVEHRYDLQYQLYSLALHRLLALR
LPGYDFDQHFGGVFYLFLRGMPQGGIFHTRPSRELVQGLDRLFSEGAASASAQEWDNGVE
A
NT seq 3606 nt   +upstreamnt  +downstreamnt
atggctaacccgctcaataccctgcgttttcccctccatggcgagcggctgatcgaggct
tccgccggcaccggcaagacctacaccatcgccggcctctacctgcgtctgctgctgggc
catggcccgctcatcgaagaaggcgccgatgctggtcaggcgagcgcccacgagcggccc
ctgtcggtgaccgagatcctggtggtgacctttaccgaggcggccaccgccgagctgcgc
gggcggatccgcgaccgcatccacgaggcgcgcctcgcctttatgcgcggtcacagcggc
gatgccctgctggcccagctgctggaggaggtggaggatcacgagctggcggcccgccgc
ctgctggccgccgagcggcagatggacgaggcggccgtcttcaccatccacggcttttgc
cagcggatgctgaaacagaacgccttcgagtcgggcgccctcttcgagaccgaatttctc
accgacgacagccagctcaggctgcaggcggtgagcgactactggcgcgccgagttctat
ctggtggataaaaccctggcaagcgccgtgcgcgcgctctggccaagccccgccgcgctg
ctgcgggagatgaacggctggctcgacaacagcgaactggagatgcgcccgccggtgggg
gacgagaccctggcggcccgccatcaggtggccatggcccgtatcgaggcggtgaaagcg
gcctggctggcgcaggtggacgagatccgccgccagaccgacggccatatcagccgctac
accggcaagaactacgaaggctggctcgccaagatagccgactgggcgcaagacgagacc
agcggctacgccattcccaaggagctggagcgtttcggtcagacggtgctggaggaaaac
ctcaagaaggggggggcggtgcctaccctgccgctattcagcgagatcgacgcgctgctg
gcgagccgccccggtatccgagatctgatcctgcagcgggccgccgtggtggtgcgcagc
cggatgcatgcgagcaagcgccaggcccatcagctctcgttcgacgatctgctcaaagac
ctcgacggggcgctgggttctagccttggcgaacggctgtgcgatcgtattcgcgccacc
taccgggtcgccatgatcgatgaattccaggataccgacccccagcagtaccgtatcttc
catcggctgtacggcggccatcaggacacggcgctgctgatgatcggtgaccccaagcag
gccatctatggctttcgcggcgccgacatcttcacctacattcaggcgcggcgaaatgtg
agcgcccactacaccctggggcgcaactggcgctccagcggcgccctggtagcggcggtc
aacggcctgttcgagcgggccaaggatccctttatctacgaggcggatatccccttcctg
ccggtggaggcgcagggcaagagcaaggcgttgcgcctcgatggtgaaaccgcccccgtg
ctgcactgctggcagctcaccggccagcccaccttcaaccggggggactaccagagcagg
atggcccgcgccacggcggcggagatccaccgcctgctgagcctggcccgcgagggcaag
gcgctgatcggcagtgagccggtgaaagcgggcgatatcgccgtgctggtgcgcaccggc
gccgagggcaagctggtgcagcaggagctggcacgcctcgccatcgcctcggtttatctg
tcgaatcgcgagagcgtgctggagcaggtggaggcgcgggagatcctgctgatcctgcac
gcctgccagaacccgagcgaggagagaagtttgcgggcggcgcttgccaccggcctgttc
gatctcgacgccaaggccctcgacgagcttgcctcggacgagcgggcgtgggagaacgcg
gtgcaggagtttatggagtaccgcaaggtctggcacaagcgcggtgtgctggccatgctg
cgggccctgctgcaccggcgcaatctcgcctcttcgcttttggcgagcccctacggtgag
cggcggctgaccaacttcctccatctgggggagctcttgcagcaggtgagcagcgagctg
gacggcgaatacgccctgctgcgctggctgggggaggcggtgaaccgccagagcggccag
gatgcggagcagatacttcgcctggagtccgagcgcaagctggtgcagatcgtcaccatc
cacaaatccaaggggctggagtacccgctggtgttcctcccctttatctgcagccaccgc
agcgccgacaccccgctctatcacgaggccgatgaggcgggcaaccgcaccatcctcgat
ctcaccggcgccgaggattccttggcagaggccgacaaagagcgcctcgccgaagacttg
cgcctgctctacgtggcgctgacccggggcgtttacgccacctggctggggctggcgccg
gtgcgctccggcaacggcaagtcggagaagaccgacctgcaccagaccgccatcggctac
ctgctgcaaaagggggaggagggggacgcagcgaccctggccaccgccctcagtgcgctt
gctgaggatctgcccggggtggccgtcggtgagccctcgctcactcgcccggccccgttg
ccggccgaagaggagcaactgggcgagcccaaggtgcgccgctttggcggcacccttgag
cgggactggtggatcagctcctactccggtctcgcggcccagggccacggtcacagcaag
ggcgtattggccaatcccggcttcgatgacgaggtggtcaccgaggcggcggcgctggct
gccgaagagccagtgcaggcgccccagccctccatcttcaccttcccgaagggggcgcgt
cccggtaccttgctgcacagcctgttcgagaccatcgactttgagagtgccgcaggcgag
ccgctggcacagcatatcgccaccctgctggcgcaggacggcttcgacgagagctgggcc
caagtgctgcaacagcaggtggaggcggtgctggataccccgcttgaaacgggctttggc
gagccggtacggctgcgggatctggcccccgagcgcaagcaggtggagctggagttcttc
ctgcccatggggcgggtgacggcccctgcgctgaccgcgctctgccagcagcacgacccg
ctgtcacggggcaacaagccgctcagcttcgccaccgtgcaggggatgctcaagggcttt
atcgacctggtgttcgagtggcaggggcgctggtatctgctcgactacaaatccaaccac
ctcggcatgagcccggccgactacagccggccggcgctggagcaggccatggtggagcat
cgctacgacctgcaataccagctctactccctggcgctgcaccggctgctcgccctgcgt
ctgccgggctacgacttcgaccagcactttggcggggtcttctatctgttcctgcgcggc
atgccacaaggggggatcttccatactcgccccagccgcgagctggtgcaggggctggat
cggctgtttagcgagggggcggcgtccgcctctgcacaagaatgggataacggggtagaa
gcatga

DBGET integrated database retrieval system