KEGG   Aeromonas dhakensis: CK627_03245
Entry
CK627_03245       CDS       T05186                                 

Definition
(GenBank) primosomal protein N'
  KO
K04066  primosomal protein N' (replication factor Y) (superfamily II helicase) [EC:3.6.4.-]
Organism
adh  Aeromonas dhakensis
Pathway
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CK627_03245
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_03245
Enzymes [BR:adh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     CK627_03245
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CK627_03245
SSDB
Motif
Pfam: PriA_3primeBD PriA_C DEAD Helicase_C PriA_CRR ResIII zinc-ribbons_6 AAA_30 TrwB_AAD_bind
Other DBs
NCBI-ProteinID: ASX09869
LinkDB
Position
634444..636651
AA seq 735 aa
MNSSQTLDLVRVAVPVPLRRHFDYLSPLPLPAPGCRVEIPFGPQTLVGLVVDHPAESQVP
RNKLKPIKRVLDAAPVLGPDILALMNWSASYYQHPLGEVLPHALPVLVRKGEPAAYRELE
FWFATEAGMAVDLNELKRAAKQQQALALLRKGPQTPSALKQEEIQSAALSALEKKGLLEK
RSLEPSHEGDWAARFEPGEGLRLNGEQALAVSAVTSQSDRFGAFLLDGITGSGKTEVYLS
ILEPLLKAGKQALVMVPEIGLTPQTINRFRRRFNVPVVAMNSAMNDRERLDAWLACRDGG
AAILIGTRSAVFTPFHDLGIIIIDEEHDGSFKQQDGFRYHARDLAVMRAHRAGIPILLGS
ATPSLETLHNARSGKYHHLSLTRRAGNAQTARQVILDIKNVRLQAGLSPQLEQLMAEHLA
AGNQVMLFLNRRGYAPALICHQCGWSAACERCDAWYTWHQAGRRLHCHHCDSVRPLPHHC
PECGSNELIGSGVGTEQLEQLLGTVFPQYPVVRIDRDNTRRKGELETHLGDIKAGKYKIL
IGTQMLAKGHHFPDVTLVGLLDVDGALFSADFRAAEKLAQLYTQVAGRAGRASKPGLVVL
QSHHPEHALLQDLTQNGYGHFADTALKERRLLGLPPFSYQGLFRAEANGRDEVQLFLARL
ADTLRSARYPHVQVLGPISGFMERKAGKFRMQLLVQGPSRAPLAQLLDWAVKELEGWPET
KRVRWSLDIDPTELN
NT seq 2208 nt   +upstreamnt  +downstreamnt
gtgaattcttcccaaacgctggatctggttcgtgtggctgtgccggtgccgttacgccgt
catttcgactatctctcccccctgcccttgcctgcccccggctgccgggtcgagatcccg
ttcggcccgcaaaccctggtcggactggtggtggatcacccggccgagagccaggtgccg
cgcaacaagctcaaacccatcaagcgggtattggatgcggcgccagtgctggggccggat
atcctggcactgatgaactggagtgccagctactaccagcatccgctgggggaggtgctg
ccccacgccctgccggtgctggtgcgcaagggggagcccgccgcctatcgggagctggag
ttctggtttgccaccgaggccggcatggcggtcgatctcaacgagctcaagcgggcggcc
aagcagcagcaggcgctcgccttgctgcgcaaggggccgcagaccccctccgctctcaag
caggaggagatccagagtgcagcactcagcgcactggagaagaaggggctgctggagaaa
cgctcgctggagccaagccatgagggtgactgggccgcccgcttcgagccgggcgagggg
ctgcgtctcaacggtgagcaggcgctggcggtctctgccgtcaccagccagagcgacagg
ttcggcgcctttttgctggatggcatcaccggctccggcaagaccgaggtctacctgagc
atcctcgagcccctgctcaaggcgggcaagcaggcgctggtgatggtgccggagataggc
ctcaccccgcagaccatcaaccgctttcgccgccgcttcaacgtgcccgtggtggcgatg
aactcggccatgaacgacagggagcggctcgatgcctggctggcctgccgcgacggcggt
gccgcgatacttatcggcacccgctccgcggtgttcaccccgtttcacgacctcggcatc
atcatcatcgacgaggagcacgacggctccttcaaacagcaggatggctttcgctaccac
gctcgggatctggcggtgatgcgggcccaccgtgccggcattcccatcctgctcggctcg
gccaccccgtcgctggagacgctgcacaacgcccgcagcggcaagtatcaccacctcagc
ctgacccggcgcgccggcaacgcccagaccgcccgccaggtgatcctggacatcaagaac
gtgcggctgcaggcggggctctccccccagctggaacagctgatggcagagcatctggcg
gccggcaaccaggtgatgctgtttctcaaccgccgtggctatgcgccggccctcatctgc
catcaatgtggctggagtgccgcctgcgagcgctgcgatgcctggtacacctggcaccag
gccgggcggcggctgcactgccaccactgcgacagcgtgcgcccgctgccccaccactgc
cccgagtgtggcagcaacgaactgatcggatccggggtcggcaccgaacagctggagcag
ctgctcggcaccgttttcccgcaatatccggtggtgcgcatcgatcgggacaacacccga
cgcaagggggagctggagacccacctcggcgacatcaaggccggcaagtacaagatcctg
atcggcacccagatgctggccaagggccaccacttcccggacgtgacattggtaggactg
ctggatgtggatggtgccctgttcagtgccgattttcgcgccgccgagaaactggcccag
ctctacacccaggtggcgggtcgtgccggtcgcgccagcaagccgggtctggtggtattg
cagagccatcacccggagcacgccctgctgcaggatctgacccagaacggctacggccac
ttcgccgacacggcgctgaaagagcgccgcctgctgggactgccgccattcagctatcag
gggctgtttcgggccgaggccaacggccgcgacgaggtgcagctgttcctcgcccgcctc
gccgacaccctgcgcagcgcccgctacccacatgtgcaggtgcttgggcccatcagcggc
ttcatggagcgcaaggcgggcaagttccgcatgcagttgctggtacaggggcccagccgg
gcgccactggcccaactgctggattgggcggtgaaggagctggaggggtggcccgagacc
aagcgggtacgctggagcctcgacatagaccccaccgagctgaattga

DBGET integrated database retrieval system