KEGG   Aeromonas dhakensis: CK627_03895
Entry
CK627_03895       CDS       T05186                                 

Definition
(GenBank) DNA replication/repair protein RecF
  KO
K03629  DNA replication and repair protein RecF
Organism
adh  Aeromonas dhakensis
Pathway
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CK627_03895
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_03895
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     CK627_03895
SSDB
Motif
Pfam: SMC_N AAA_23 AAA_15 AAA_21 AAA_27 AAA_29 DUF2813 ABC_tran AAA_16 AAA_22
Other DBs
NCBI-ProteinID: ASX09979
LinkDB
Position
complement(781613..782716)
AA seq 367 aa
MSLVKLQLSDFRNIQQASLALSPGLNILVGCNGSGKTSVLEAIHYLGLGRSFRTHLTGRV
IRQGERAFTLFAQCELEGRQVPIGLAKDKSGETQLKIAGAQALRLADLAELLPVQLIHPD
GFNLLTGGPQARRAWLDWGVFHQEPTFFSLWGRVRRLLKQRNALLRQSTQYRQLAFWDQE
LVRLGGELAEFRASYCQAITPLIKEMTADFLPEFDISLGFYRGWEKDTPLNELLEAGFER
DRTLGYTGVGPQKADVRLKANGVPAQDILSRGQLKLLVCAMRLAQGLYLNQHSSRGCIFL
IDDFASELDVDKRRLLAARLKQCASQVFITAIDTGQLADMMDANDCKLFHVEQGKISETL
EKAESKL
NT seq 1104 nt   +upstreamnt  +downstreamnt
gtgtccctggtcaaactccagctcagcgactttcgcaatatccagcaggccagtctcgcg
ctgtcacccggcctcaatatcctggtcgggtgcaacggcagcggcaagaccagcgtgctg
gaagccattcactacctcggtcttggtcgctcctttcgcactcacctgaccgggcgggtc
atccgccagggggagagggcgtttaccctgttcgcccagtgcgaactggaagggcgccag
gtgcccatcggcctcgccaaggacaagagtggcgagacccagctcaagattgccggtgcc
caggccctgcgcctggccgacctggccgagctgctgccggtgcagctgatccacccggat
ggcttcaacctgctgaccggcgggccccaggctcgccgagcctggctcgactggggtgtt
tttcatcaggaaccgaccttcttctccctgtggggacgggtacggcggctgctgaaacag
cgcaatgcactgctgcgccagagcacccagtatcgccaactggcgttctgggatcaggag
ctggtgcggttggggggagagctggccgagtttcgcgccagttattgtcaggccattacc
cccctgatcaaggagatgacggcggactttttgccggaattcgacatcagccttggattc
tatcgaggctgggaaaaagataccccgctcaatgaattgctggaggcgggatttgagcgg
gatcggacgctgggttacacgggcgttggtccacagaaggccgatgtgcgcctcaaggcg
aacggcgtgcccgctcaggatattttgtccaggggtcagctgaagttgttggtctgtgct
atgcgactggcccaagggctctatttgaatcaacatagcagccgtggctgtattttttta
attgacgattttgcctctgaactggatgtcgacaagcgccgcttgctggccgcaaggctg
aagcagtgtgcgtcccaggtgttcatcaccgccatcgacaccggtcagctcgcagacatg
atggatgcgaatgactgcaagttgttccacgtggaacaaggcaagatctccgaaacgtta
gagaaggcagagagtaagctatga

DBGET integrated database retrieval system