KEGG   Aeromonas dhakensis: CK627_04445Help
Entry
CK627_04445       CDS       T05186                                 

Gene name
fadB
Definition
(GenBank) fatty acid oxidation complex subunit alpha FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
adh  Aeromonas dhakensis
Pathway
adh00071  Fatty acid degradation
adh00280  Valine, leucine and isoleucine degradation
adh00281  Geraniol degradation
adh00310  Lysine degradation
adh00362  Benzoate degradation
adh00380  Tryptophan metabolism
adh00410  beta-Alanine metabolism
adh00640  Propanoate metabolism
adh00650  Butanoate metabolism
adh00903  Limonene and pinene degradation
adh00930  Caprolactam degradation
adh01100  Metabolic pathways
adh01110  Biosynthesis of secondary metabolites
adh01120  Microbial metabolism in diverse environments
adh01130  Biosynthesis of antibiotics
adh01200  Carbon metabolism
adh01212  Fatty acid metabolism
Module
adh_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:adh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CK627_04445 (fadB)
   00650 Butanoate metabolism
    CK627_04445 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CK627_04445 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CK627_04445 (fadB)
   00310 Lysine degradation
    CK627_04445 (fadB)
   00380 Tryptophan metabolism
    CK627_04445 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CK627_04445 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CK627_04445 (fadB)
   00281 Geraniol degradation
    CK627_04445 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CK627_04445 (fadB)
   00930 Caprolactam degradation
    CK627_04445 (fadB)
Enzymes [BR:adh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CK627_04445 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CK627_04445 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CK627_04445 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     CK627_04445 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ASX10076
LinkDB All DBs
Position
complement(896873..899020)
Genome map
AA seq 715 aa AA seqDB search
MIYQGETLTVSYLEDGIAELRFDAPGSVNKLDRATLLSLSEAIAALQQERELKGLILTSG
KDAFIVGADITEFLELFDLPQEDLLGWLKKANDIFNAIEDLPVPTLSAIKGHALGGGCET
ILSTDFRLADTTAKIGLPETKLGIMPGFGGTVRLPRVIGADNALEWITTGKDYRADDALK
VGAIDAVVAPDALHSAAVQMIKDAIKGKLDWQSRRAAKKAPLRLSKLEAMMSFTTAAGMV
AAVAGKHYPAPMAAVKTVEAAAGMGRDEALAAEAATFIKLAKTDVAKALVGIFLNDQHIK
ALAKKAAKQANKATGHAAVLGAGIMGGGIAYQSASKGIPAVMKDINEKALALGMGEATKL
LNGQLERGRIDGIKMGQVLSAITPTLSYDNVKHVDVVVEAVVENPKVKAAVLSEVEGVIG
EDAVLASNTSTIPISLLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGEQTSDDTINRVVA
YAAAMGKSPVVVNDCPGFFVNRVLFPYFFGFNKLVADGADFAAVDKVMEKEFGWPMGPAY
LLDVVGIDTGHHAGDVMAQGFPARMSKEGRTAIDVMYEASRFGQKNGKGFYAYEADKKGK
PKKVADAASYELLAPIAKPKQDFDKDAIIARMMIPMINEVVLCLEEGIVATPAEADIALV
YGLGFPPFRGGVFRYLDTIGLDRYVAMADQYADLGPLYRVSDKLREMAAQGKTFY
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatctaccaaggcgaaaccctgacggtcagctacctcgaagacggcattgccgagctg
aggttcgatgctccgggttcagtcaacaagctggatcgcgctaccctgctctccctgagc
gaagcgatcgccgcattacaacaagaacgtgaactaaaaggtctgatcctcacctccggc
aaagacgccttcatcgtcggcgccgacatcaccgaattcctggaactgttcgatctgccg
caggaagatctgctcggctggctgaaaaaggccaacgacatcttcaacgccatcgaagat
ctgccggtgccgaccctctccgccatcaagggccacgccctgggcggcggctgcgagacc
attctctccaccgacttccggctggccgacaccacggccaagatcggtctgcccgagacc
aaactcggcatcatgccgggctttggcggcaccgtccgtctgccgcgggtgatcggcgcc
gacaacgcgctggagtggatcaccaccggcaaggattaccgtgccgatgacgccctcaag
gtgggtgctatcgatgccgtggtcgccccggatgcgctgcacagcgccgccgtgcagatg
atcaaggacgcgatcaagggcaagctggactggcagagccgccgcgccgccaagaaggcc
cctctgcgtctctccaaactggaagccatgatgagcttcaccaccgccgccggcatggtt
gccgccgtggcgggcaaacactatccggcacccatggccgccgtgaagacggtggaagcc
gccgccggcatgggtcgtgatgaagcgctggccgccgaagccgccaccttcatcaagctg
gcgaaaaccgacgtggccaaggcgctggtcggcatcttcctcaacgatcagcacatcaag
gcgctggccaagaaggccgccaagcaggcaaacaaggccaccggccatgccgccgtactg
ggtgccggcatcatggggggcggcatcgcctaccagtccgccagcaagggcatcccggcg
gtgatgaaggacatcaacgagaaggcgctggcacttggcatgggcgaagccaccaagctg
ctcaacggccagctcgagcgcggtcgcatcgacggcatcaagatgggccaggtgctctcc
gccatcaccccgaccctcagctatgacaacgtcaagcatgtggacgtggtggtcgaggcc
gtggtcgagaacccgaaagtgaaggcggccgtgctgagtgaagtggaaggcgtgatcggc
gaagacgccgtgctcgccagcaacacctccaccatccccatctccctgctggccaagagc
ctgaaacgccccgagaacttctgcggcatgcacttcttcaacccggtgcaccgcatgccc
ctggtggagatcatccgcggcgagcaaacctcggacgacaccatcaaccgcgtggtggcc
tacgccgccgccatgggcaagtccccggtggtggtcaacgactgcccgggcttcttcgtc
aaccgcgtgctgttcccctacttcttcggcttcaacaagctggtcgccgatggcgccgac
ttcgccgccgtcgacaaggtgatggagaaggagtttggctggcccatgggccccgcctac
ctgctggacgtggtcggcatcgacaccggccaccatgccggtgacgtgatggcgcagggc
ttcccggcgcgcatgagcaaggaaggccgcaccgccatcgacgtgatgtacgaggcgagc
cgcttcggtcagaagaatggcaagggcttctacgcctacgaggccgacaagaagggcaag
ccgaagaaggtggccgatgccgccagctacgagctgctggccccgattgccaagccgaaa
caggatttcgacaaggacgccatcatcgcccgcatgatgatcccgatgatcaacgaggtg
gtgctctgtctggaagagggcatagtcgccaccccagccgaagccgacatcgcgctggtc
tacggtctgggcttccctcccttccgcggcggcgtgttccgctatctggacactatcggt
ctggatcgctatgtcgccatggccgaccagtatgccgacctgggcccgctctaccgcgtc
agcgacaagctgcgtgagatggccgcccagggcaaaaccttctactga

DBGET integrated database retrieval system