KEGG   Aeromonas dhakensis: CK627_04740
Entry
CK627_04740       CDS       T05186                                 

Definition
(GenBank) DNA polymerase I
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
adh  Aeromonas dhakensis
Pathway
adh03030  DNA replication
adh03410  Base excision repair
adh03420  Nucleotide excision repair
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CK627_04740
   03410 Base excision repair
    CK627_04740
   03420 Nucleotide excision repair
    CK627_04740
   03440 Homologous recombination
    CK627_04740
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:adh03032]
    CK627_04740
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_04740
Enzymes [BR:adh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CK627_04740
DNA replication proteins [BR:adh03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     CK627_04740
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     CK627_04740
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     CK627_04740
SSDB
Motif
Pfam: DNA_pol_A 5_3_exonuc_N DNA_pol_A_exo1 5_3_exonuc HHH_5
Other DBs
NCBI-ProteinID: ASX10129
LinkDB
Position
953394..956144
AA seq 916 aa
MAPSNPLILVDGSSYLYRAFFASQQADLRTSTGLPSGAVRVMANMMRSLRKQYPDCHVAV
VFDAKGKTFRDDIYSEYKANRASMPDDLRSQVAPIHQMIKAMGFPFLMVEGVEADDVIGT
LARQATEKQLPVLISTGDKDMAQLVSDHVTLIDTMKDVKTDREGVIEKFGVPPELIIDYL
ALMGDKVDNIPGMTGVGEKTALALLQGIGSIDEIAANLDKVAALGFRGSKAFADKFREQE
EQVRLSYVLATIKTDVALEQSLEELELGPIDKEALLAVYREYELRNLIKELESGAEESGA
EGEEEGVAPAAAIETDYRCILDEAEFDEWLARLQAAPLFAFDTETTSLDYMEARVVGVSF
AIEPGKAAYVPFGHDYLGAPVQLTEAVVLGKLKPLLEDPARLKVGQNLKYDRNVLLNHGI
ELQGIAYDTMLESYVLNSTASRHDMDSLARRYLNVETISFEEIAGKGVKQLTFNQIELEQ
AAPYAAEDADITLRLHQALWGKLAAEPGLAKVFSEIELPLLPVLARMERLGTTIEPKLLH
QQSQEIEVRLAELEKQAHELAGQEFNLSSPKQLGEILFTKLGLPIIKKTPKGAPSTAEEV
LAELAETYELPRLLMGHRGLAKLKSTYTDKLPLMIKPQTGRVHTSYHQAVAATGRLSSTD
PNLQNIPVRNEQGRRIRQAFIPCAGYKLVAADYSQIELRIMAHLSGDKGLLTAFAEGKDI
HKATAAEVFGVALEAVTSDMRRSAKAINFGLIYGMSAFGLAKQLGIGRAEAQKYMDLYFE
RYPGVLEYMERTRQQAEAQGYVETLFGRRLYLPDIKSRNAGLRKAAERAAINAPMQGTAA
DIIKRAMINVDGWIRGIEDQSIRMLMQVHDELVFEIREEKLEEYIAIIKEKMSAAAELHV
PLVVEAGTGDNWDQAH
NT seq 2751 nt   +upstreamnt  +downstreamnt
atggcccctagcaatccccttattctggtcgacggctcctcttatctttaccgcgccttc
tttgcctctcagcaggccgatctgcgcacctcgaccggtttgccgagcggcgccgtccgc
gtcatggccaacatgatgcgcagcctgcgcaagcagtaccccgactgccatgtggccgtg
gtgttcgatgccaagggcaagaccttccgcgacgacatctattccgaatacaaggccaac
cgggccagcatgccggacgatctgcgcagccaggtggcccccatccaccagatgatcaag
gcgatgggcttccccttcctgatggtggagggagtggaggccgacgacgtgatcggcacc
ctggcccgtcaggcgaccgagaaacagctgccggtgctgatcagcaccggcgacaaggac
atggcgcagctggtctccgaccatgtcaccctgatcgacaccatgaaggacgtgaagacc
gatcgggaaggggtgatcgagaagttcggcgtaccgccagagctcatcatcgactacctg
gccctgatgggggacaaggtggacaacatccccggcatgaccggcgtcggcgagaagacc
gcgctggccctgctgcaggggatcggcagcatcgacgagatcgccgccaacctcgacaag
gtggcggcgctcggctttcgcggttccaaggcgttcgccgacaagttccgcgagcaggag
gagcaggtgcgcctctcttatgtgctggccaccatcaagaccgacgtggcgctggagcag
agcctggaagagctggagcttggccccatcgacaaggaggccctgctggcggtttaccgc
gagtatgagctgcgcaaccttatcaaggagctggagtccggcgccgaggagagcggcgct
gaaggggaggaggaaggcgttgccccggcagccgccatcgaaactgattatcgctgcatt
ctggacgaggccgaatttgatgagtggctggcacgcctgcaggcggcgccgctgtttgcc
ttcgacaccgagaccaccagtctcgactatatggaggcgcgggtggttggcgtctccttt
gccatcgaaccgggcaaggcggcctacgtgcccttcggtcacgactatctgggggcgccg
gtgcagctgaccgaggctgtggtactcggcaagctcaagccgctgctggaagatccggcc
cgcctcaaggtggggcagaacctcaagtacgatcgcaacgtgctgctcaaccacggcatc
gagctgcagggtatcgcctacgacacaatgctggagtcctatgtgctcaactccaccgcc
agtcgtcacgacatggactcgctggcccgcaggtatctgaacgtcgagaccatctcgttc
gaagagattgctggcaagggggtcaagcagctcaccttcaaccagattgagctggagcag
gcggccccctacgcggcggaagatgccgacatcaccctgcgcctgcatcaggcgctgtgg
ggcaagcttgctgccgagccgggcctcgccaaggtattcagcgagatcgaactgccgctg
ctgccggtgctggcacggatggagcggctcggcaccaccatcgagcccaagctgctgcat
cagcagagccaggagatcgaagtgcggctggcagagctggagaaacaggcccacgagctg
gccggacaggagttcaatctctcctcgcccaagcagctgggggagatcctcttcaccaag
ctggggctgccgatcatcaaaaagacccccaagggcgcgccatccactgcggaagaggtg
ctggccgagctggcggagacctatgagctgccgcgcctcctgatggggcaccgtggtctg
gccaagctcaagtccacctacaccgacaaactgccgctgatgatcaagccgcagaccgga
cgggtgcacacctcctatcatcaggcggtggcggcgaccggtcgactgtcgtcaaccgat
cccaacctgcagaacatcccggtacgcaacgaacaggggcgccgcatccggcaggccttc
attccgtgcgccggttacaagctggtggcggcggactactcccagatcgagctgcgcatc
atggcgcacctctccggcgacaaggggttgctgaccgctttcgccgagggcaaggacatc
cacaaggcgaccgccgccgaggtattcggggtcgcgctcgaggcggtgaccagcgacatg
cgtcgcagtgccaaggcgatcaacttcggcctcatctacggcatgagtgccttcggtctg
gccaagcagctggggatcggccgtgccgaagcgcagaagtacatggatctctacttcgag
cgctacccgggtgtgctggagtacatggagcgcacccgccagcaggcggaagcccagggc
tatgtcgaaaccctgtttggtcgccgcctctatctgccggacatcaagtcccgcaacgcc
ggtctgcgcaaggcggcggaacgggccgccatcaacgcccccatgcagggtacggccgcc
gacatcatcaagcgcgccatgatcaacgtggatggctggatcaggggcattgaagaccag
tcgatccgcatgttgatgcaggtgcacgatgaactggtgttcgagatccgcgaagagaag
ctggaggaatacatcgccatcatcaaggagaagatgtcagccgccgccgaattgcatgtg
ccgctggtggtcgaagcgggcaccggtgacaactgggatcaggcccactga

DBGET integrated database retrieval system