KEGG   Aeromonas dhakensis: CK627_05210
Entry
CK627_05210       CDS       T05186                                 

Definition
(GenBank) ATP-dependent DNA helicase RecG
  KO
K03655  ATP-dependent DNA helicase RecG [EC:3.6.4.12]
Organism
adh  Aeromonas dhakensis
Pathway
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CK627_05210
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_05210
Enzymes [BR:adh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CK627_05210
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     CK627_05210
SSDB
Motif
Pfam: Helicase_C RecG_wedge DEAD ResIII tRNA_anti-codon IMS_HHH SecA_DEAD AAA_30 SNF2_N Cdd1
Other DBs
NCBI-ProteinID: ASX10212
LinkDB
Position
complement(1054363..1056435)
AA seq 690 aa
MMKLDKISLDSLKGVGSKMQEKLERLGLATVQDLLFHLPLRYEDRTQVWPIGDLPPGLHG
AVEGEIQDTQLVMGRRRMLVCRISDGTGTLTLRFFNFTAAQKNSLSPGRLMRCFGEVRPG
KYGLEMAHPEYKLLGEEQAGQTEEALTPVYPTTEGLRQLTLRSLTDQALAQLDLYGVEEL
LPAGLYPQQIDLAAALKLLHRPPPSVALALLESGQHPAQQRLVLEELLAHNLSVLKVRAQ
AQTQLARALKPAPALVEQLLGALPFTPTGAQNRVVAEIGKDLQQSHPMMRLVQGDVGSGK
TLVAALAALQAIGNGCQVGLMAPTELLAEQHAINFAKWLEPLGIGVGWLAGKQKGKAREE
ALAAIADGSVKMVVGTHAIFQEQVVFQRLALVIIDEQHRFGVHQRLALREKGEREGVHPH
QLIMTATPIPRTLAMTAYADLDTSIIDELPPGRTPITTVALPDSRRQDVIERVRLACEEG
KQAYWVCTLIEESEVLECQAAEDTAAELQNRLPGLHIGLVHGRMRPVEKQRVMEEFKAGI
LQLLVATTVIEVGVDVPNASLMIIENPERLGLAQLHQLRGRVGRGSVASHCVLLYHAPLS
KTAQSRLGVLRETNDGFLIAQRDLELRGPGELLGTRQTGLADLKIADLVRDQPLIPQVQK
MARFLMDRHPDHVEPLIRRWLGLRDHYSNA
NT seq 2073 nt   +upstreamnt  +downstreamnt
ttgatgaaattggataaaatctccctcgacagcctcaagggcgtcggcagcaagatgcag
gaaaagctcgagcggctggggctggccacggtgcaggatctgctgttccacctccccctg
cgctacgaggaccgcacccaggtgtggcccatcggcgatctgccgcccggcctgcacggc
gccgtcgagggggagatccaggacactcagctggtgatggggcgccgccgcatgctggtc
tgccgcatcagcgacggcaccggcaccctcaccctgcgcttcttcaacttcaccgccgcc
cagaagaacagcctgagtccgggccggctgatgcgctgcttcggcgaggtgcgccccggc
aagtacgggctggagatggcccaccccgagtacaagctgctcggcgaggagcaggccggc
cagaccgaagaggcgctcacccccgtctatccgaccaccgaggggctgcgccagctcacc
ctgcgcagcctcaccgatcaggcgctggcccagctcgacctctacggcgtggaggagctg
ctgcccgccggcctctatccccagcagatcgatctggccgcggctctgaagctgctgcac
cgtccgcccccctcggtggcgctggccctgctggaaagcggccagcacccggcccagcag
cgactggtgctggaggagctgctggcccacaacctatctgtgctcaaggtgcgggcccag
gcacagacccagctggcccgcgccctcaagccggccccggccctggtggaacagctgctc
ggtgccctgccgttcacccccaccggtgcccagaaccgggtggtggccgagataggcaag
gatctgcagcagagccaccccatgatgcggctggtgcagggggacgtaggctccggcaag
accctggtcgcggcgctggccgccctgcaggccatcggcaacggctgtcaggtggggctg
atggcgccgaccgagctgctggccgaacagcacgccatcaacttcgccaagtggctggaa
ccgctcggcatcggggtgggctggctggcgggcaagcagaagggcaaggcgcgggaggag
gcgctggctgccatcgccgacggcagcgtcaagatggtggtgggcacccatgccatcttc
caggagcaggtggtgttccagcgcctcgccctggtgatcatcgacgaacagcacagattc
ggtgtgcatcagcgcctcgccctgcgggaaaaaggagagcgggagggggtacatccccac
cagctcatcatgaccgccacccccatcccccgcaccctggcgatgaccgcctatgccgac
ctcgacacctccatcatcgacgagctgccgccgggccgcacccccatcaccacggtggcg
ctgccggacagtcgccgccaggacgtgatcgaacgggtcagactggcctgtgaggagggc
aagcaggcctactgggtctgcaccctgatcgaggagtcggaggtactggagtgccaggcc
gccgaggacaccgccgccgagctgcaaaatcggctgcccggcctgcacatcgggctggtg
cacggccggatgcggccggtcgagaaacagcgggtgatggaggagttcaaggcgggcata
ctgcaactgctggtcgccactaccgtcatcgaggtgggggtggacgtgcccaacgccagc
ctgatgatcatcgaaaacccggagcgactggggctggcgcagttgcaccagctgcgcggc
cgggtcgggcgcggctcggtggcctcccactgcgtgctgctctatcatgctcccttgtcc
aagacggcccagagccggctcggggtgctgcgggagaccaacgacggcttcctcatcgcc
cagcgcgatctggagctgcgcggcccgggggaactgctcggcacccgccagactggcctg
gccgatctcaagatcgccgatctggtgcgggatcaaccgctcatcccgcaggtgcagaag
atggcgcgcttcttgatggaccgccacccagatcatgtcgaacccttgatacgacgctgg
ctcggcctgcgggatcactactccaatgcctga

DBGET integrated database retrieval system