KEGG   Aeromonas dhakensis: CK627_06230Help
Entry
CK627_06230       CDS       T05186                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
adh  Aeromonas dhakensis
Brite
KEGG Orthology (KO) [BR:adh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:adh02000]
    CK627_06230
Transporters [BR:adh02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    CK627_06230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_22 SbcCD_C AAA_30 AAA_23 CysG_dimeriser AAA_29 Rad17 AAA_27 DUF4162 AAA_16 AAA RNA_helicase
Motif
Other DBs
NCBI-ProteinID: ASX10399
LinkDB All DBs
Position
1254856..1255785
Genome map
AA seq 309 aa AA seqDB search
MSELAIRALGVSRRFGNFLAVDGLDLCVPKGQIHGFLGPNGCGKSTTLRMLTGLLTPSAG
EVEVLGLSIPREAETLRRRIGYMTQKFSLYDELTAWENLEFMGRIHGMGGAGLAARLHEL
LATYELAPLARQRAGAMSGGQKQRLALAAAVIHQPALLLLDEPTSAVDPQNRRDFWEKLF
DLSEGGTTILVTTHYMDEAERCHQLAIMEAGRVRAQGAPQALMDAMSTRVVEVQAADLRL
LKQQLVQLAPVHSAAQLGQRLRVLVDKELAEPVAWLQQACPALAGATLALVRPSLEDVFV
SCTGQEPRA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctggcgatccgggcgctgggggtgagccgccgcttcggtaattttctggcg
gtggacgggctggatctctgcgtgcccaaggggcagatccacggctttctcggccccaac
ggctgcggcaagtccaccaccctgcgcatgctgaccggcctgctcaccccctcggcgggg
gaggtggaggtgttggggctgagcatcccccgcgaggccgagaccctgcgccggcggatc
ggctacatgacccagaagttctccctctatgacgaactgactgcctgggagaacctggag
ttcatggggcggatccacggcatgggcggcgccgggctggccgcccgcctgcacgagctg
ctcgccacctatgagctggcgccgttggcacggcaacgggccggtgccatgagcggcggc
cagaagcagcggctggcgctggcggcggcggtgatccaccagccggcgctgctgctgctc
gatgagcccacctcggcggtggacccgcagaaccggcgcgatttctgggagaagctgttc
gatttgagcgaagggggcaccaccattctggtcaccacccactacatggacgaggcggaa
cgctgccaccagctggccatcatggaggcgggccgggtacgggcccagggggcgccacag
gcgctgatggatgccatgagcacccgggtggtggaggtgcaggctgccgacctgcggctg
ctcaagcagcaactggtgcagctggcgccggtgcactccgccgcccagctcggccagcgc
ctgcgggtgctggtggacaaggagctggcggagccggtggcctggctgcaacaggcctgc
ccggcgctggctggcgccaccttggcgctggtcaggccgagcctcgaggatgtgttcgtc
agctgcaccggtcaggagccgagggcatga

DBGET integrated database retrieval system