KEGG   Aeromonas dhakensis: CK627_07935
Entry
CK627_07935       CDS       T05186                                 

Gene name
recO
Definition
(GenBank) DNA repair protein RecO
  KO
K03584  DNA repair protein RecO (recombination protein O)
Organism
adh  Aeromonas dhakensis
Pathway
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CK627_07935 (recO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_07935 (recO)
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     CK627_07935 (recO)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CK627_07935 (recO)
SSDB
Motif
Pfam: RecO_N RecO_C
Other DBs
NCBI-ProteinID: ASX10719
LinkDB
Position
1612872..1613582
AA seq 236 aa
MLTPAFVIHSRPYRETSQLVEVFTQDSGRFTLVARGSRGPRSPLKGLLQPFTLLTIAWRG
KGDLKNLTQVECPDHSLRLGGDRLFYGLYLNELVYYLLEAHTPFPEVFDAYARAIMALAD
GETPELPLRRFEFLLLQALGYAVDFEYTADDESPIEPTLLYGFERELGFVACERAPDPRT
LFLGAHLLAFAEGRFDTPPLLQAAKRFSRLALQPYLGRRQLKSRELFLKRRGAGQG
NT seq 711 nt   +upstreamnt  +downstreamnt
ttgctgaccccggctttcgtcatccacagtcggccctatcgggagaccagccagctggtc
gaggttttcacccaggatagtggccgttttaccctggtggctcgcggttctcgcgggcca
cgctcgcctctgaaggggctgttgcagccctttaccctgctcaccatcgcctggcgtggc
aagggggatctcaagaatctcacccaggtcgagtgcccggatcactccctgcgcctcggt
ggcgatcgcctcttctacggcctctatctcaacgagctggtctactacctgctggaagcg
cacacccccttccccgaggtgttcgatgcctatgcccgcgccatcatggcgctggccgac
ggcgagaccccggaactgccgctgcgccgcttcgagttcctgctgttgcaggcgctgggc
tatgcggtggatttcgagtacacggcggatgacgagtcgccgattgagccaaccctgctc
tacggcttcgagcgggagttgggctttgtcgcttgcgagcgggcgccggatccccgtacc
ctgtttctcggcgcgcacctgctggcctttgccgaggggcgcttcgatactccccccctg
ttgcaggcggccaagcgtttcagccggctggcgctgcaaccctatctgggacggcgtcag
ttgaagagccgggagctgtttttaaagcgcagaggtgcaggccagggctga

DBGET integrated database retrieval system