KEGG   Aeromonas dhakensis: CK627_09360
Entry
CK627_09360       CDS       T05186                                 

Definition
(GenBank) single-stranded-DNA-specific exonuclease RecJ
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
adh  Aeromonas dhakensis
Pathway
adh03410  Base excision repair
adh03430  Mismatch repair
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CK627_09360
   03430 Mismatch repair
    CK627_09360
   03440 Homologous recombination
    CK627_09360
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_09360
Enzymes [BR:adh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     CK627_09360
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     CK627_09360
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     CK627_09360
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CK627_09360
SSDB
Motif
Pfam: DHHA1 RecJ_OB DHH
Other DBs
NCBI-ProteinID: ASX10975
LinkDB
Position
1906102..1907832
AA seq 576 aa
MPLLIRRRPRVDDSHLPATLHPLLRQIFASRGVEDPALLERSANQLLPPQRLFGMAQAVP
LLAEALTAQKRILIVGDFDCDGATSSALCVLALRAMGGRHIDFLVPNRFEFGYGLTPEIV
ELAVARGAEFLITVDNGISSIAGVAAAKAAGMQVLVTDHHLPGQELPDADAIVNPNQHGC
DFPSKSLAGVGVAFYLMAALNTHLRQSGWYERQGLRAPNVADYLDLVALGTVADVVALDG
NNRILVHQGLQRIRAGRCRPGIQALVDVSGRDGRRLCAADLGFALGPRLNAVGRLDDMSL
GVACLLSEDINLARQLASEMDSLNQERKEIEQGMQQEALATLEQIRFRDGEVPSGIVLHR
DEWHQGVVGLVASKVKEKYYRPVIAFAESSETELKGSGRSIPGVHLRDALELLDTRHPGL
MGKFGGHAMAAGLTLPKANIEAFGRAFEAVIGELVTPELLTGVLLTDGELLPDELTLELA
ELIRASGPWGQAFPEPLFDGEFVLVQQRLVGEKHLKMMLTTDSGHAVDAIAFGVDLQRWP
DASVKRVRLVYRLDVNEWRGNRSVQLLVEHLEAAGL
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgcccctgctaatccgtcgtcgtccgcgcgtggatgattcccatctgcccgccaccctt
catcccttgctgcggcaaatcttcgccagccgtggggtcgaagaccctgccctgctggag
cgcagcgccaatcagctgctgccaccccagcgcctgttcggcatggcgcaggcagtgccc
ctgctggccgaggcgctgacggcgcaaaagcgcattctcatcgtcggtgacttcgattgt
gacggcgccaccagctcggccctgtgcgtgctggccctgcgcgccatgggggggcgccac
atcgattttctggtgcccaaccgcttcgagttcgggtatggcctcacccccgagatcgtc
gagctggcggtggcccgcggcgccgaattcctcatcacggtggacaacggcatctccagc
atcgccggggtggcggcagccaaggcggccggcatgcaggtactggttaccgatcaccat
ttgccgggccaggagctgcctgatgccgacgcgatagtgaaccccaaccagcatggctgc
gattttccctccaagtctctggccggggtcggggtcgccttctatctgatggcggcgctc
aacacccatctgcgccagagtggctggtatgagcgccaggggctgcgcgcccccaacgtg
gcggattacctggatctggtagcccttggcacggtggccgacgtggtggcgctcgatggc
aacaaccgcatcctggtccatcagggcctgcagcggatccgggccggccgctgccgcccc
ggcatccaggcgctggtggacgtgtcgggccgcgatggtcgtcgcctgtgcgccgccgat
ctcggctttgcgctggggccgcgcctcaacgcggtgggccggctcgacgacatgtccctc
ggggtcgcctgcctgctgagcgaggacatcaacctggcgcgccagctcgcctccgaaatg
gacagcctcaaccaggagcgcaaggaaatagagcaggggatgcagcaggaggcgctggcc
accctggagcagatccggtttcgtgatggcgaggtgccctccggtatcgtgctgcaccgg
gacgagtggcatcagggggtggtggggctggtggcctccaaggtgaaggagaagtactac
cgcccggtcatcgcgtttgccgagagcagcgagaccgagctcaagggctccgggcgctcc
atccccggggtgcacctgcgcgatgcgctggaactgctcgatacccgtcaccccggcctg
atgggcaagtttggcggccacgccatggcggccgggctgaccctgcccaaggcaaatatc
gaggccttcgggcgggcgttcgaggcggtcatcggcgagctggtgacccctgagctcttg
accggggtgctgctcaccgacggcgaactgctgccggacgagctaaccctcgagctggcg
gagctgatccgtgcctccggcccctggggtcaggccttccccgagccgctcttcgatggc
gagttcgtgctggtgcagcagcggctggtgggggagaagcacctcaagatgatgctgacc
acggattccggccacgcggtggatgccatcgccttcggggtcgacttgcagcgctggccc
gatgcctcggtcaaacgggtgcggctggtctaccggctcgacgtcaacgagtggcgtggc
aaccgcagcgtgcaactgctggtggagcatctggaggccgccggcctctga

DBGET integrated database retrieval system