KEGG   Aeromonas dhakensis: CK627_13030Help
Entry
CK627_13030       CDS       T05186                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
adh  Aeromonas dhakensis
Pathway
adh00473  D-Alanine metabolism
adh01100  Metabolic pathways
adh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:adh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CK627_13030 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CK627_13030 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:adh01011]
    CK627_13030 (alr)
Enzymes [BR:adh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CK627_13030 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:adh01011]
 Precursor biosynthesis
  Racemase
   CK627_13030 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ASX11641
UniProt: A0A249CY66
LinkDB All DBs
Position
complement(2746406..2747632)
Genome map
AA seq 408 aa AA seqDB search
MHKKTLLATLILGLLAGQAVAAPYLPLASDHRNGEVQTASNAWLEVDLGAFEHNIQTLKD
RLGDKGPKICAIMKADAYGHGIDLLVPSVVKAGIPCIGIASNEEARVAREKGFTGRLMRV
RAATPDEVEQALPYKMEELVGSLVSAQGIADIAQRHHTNIPVHIALNSAGMSRNGIDLRL
ADSKEDALAMLKLKGITPVGIMTHFPVEEKEDVKMGLAQFKLDSQWLLEAGKLDRSKITI
HAANSFATLEVPDAYFDMVRPGGLLYGDSIPSYTEYKRVMAFKTQVASVNHYPAGNTVGY
DRTFTLKRDSWLANLPLGYSDGYRRALSNKAYVLIQGQKVPVVGKTSMNTIMVDVTDLKG
VKPGDEVVLFGRQGEAEVKQADLEEYNGALLADMYTIWGYTNPKKIKR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagaagacactgctggccaccctgatcctgggcctgctggccggtcaggccgtc
gcggccccctatctgccgctcgccagcgatcaccgcaacggcgaagtgcagaccgccagc
aatgcctggctggaagttgatctcggcgccttcgagcacaacatccagaccctcaaggat
cgcctcggtgacaagggccccaagatctgcgccatcatgaaggcggacgcctacggccac
ggcatcgacctgctggtcccctcggtggtcaaggcgggcatcccctgcatcggcatcgcc
agcaacgaagaggcccgcgtggcccgcgagaagggcttcaccggccgcctgatgcgggtg
cgtgccgccaccccggatgaggtagagcaggctctgccctacaagatggaggagctggtt
ggcagcctggtgagtgcccagggcatcgccgacatcgcccagcgccaccacaccaatatc
ccggtgcacatcgcgctcaactccgccggcatgagccgcaacggcatcgatctgcgtctg
gctgattccaaggaagacgcgctggccatgctcaagctcaaggggatcaccccggtcggc
atcatgacccacttcccggtggaggagaaagaggacgtcaagatgggtctggcccagttc
aagctggactcccagtggctgctggaagcgggcaagctggatcgcagcaagatcaccatc
cacgccgccaactccttcgccaccctggaagtgccggacgcctacttcgacatggtgcgc
ccgggcggcctgctgtacggtgactccatcccctcctacaccgagtacaagcgggtaatg
gcgttcaagacccaggttgcctccgtcaaccactacccggccggcaacaccgtcggttat
gaccgcaccttcaccctcaagcgcgactcctggctcgccaacctgccgctgggctactcc
gacggctatcgccgcgcgctgagcaacaaggcctatgtgctgatccagggccagaaggtg
ccggtcgtcggcaagacctccatgaacaccatcatggtggacgtgaccgatctgaaggga
gtcaaacccggtgacgaggtggtgctgttcggccgccagggtgaggccgaggtgaaacag
gcggatctggaggagtacaacggtgccctgctggcggacatgtacaccatctggggctac
accaaccccaagaagatcaaacgctaa

DBGET integrated database retrieval system