KEGG   Aeromonas dhakensis: CK627_13550
Entry
CK627_13550       CDS       T05186                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
adh  Aeromonas dhakensis
Pathway
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CK627_13550
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_13550
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     CK627_13550
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CK627_13550
SSDB
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH Toprim_2
Other DBs
NCBI-ProteinID: ASX11734
LinkDB
Position
2867571..2868173
AA seq 200 aa
MKFSPLLDEMMKALQVLPGVGPKSAQRMAFTLLERERSGGLRLAQLLSRALTEIGHCSHC
RTFTENERCEICANPKREENGLLCVVESPADVAAIEQTGQFSGRYFVLMGHLSPLDGIGP
EELGLEILERRLKDEAISELILATNPTIEGDATAWYIADMARAAGVKVSRIAHGVPVGGE
LELVDGTTLSHSLMGRQPLN
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaaattcagcccgctgctggatgagatgatgaaagccctgcaggtgctgccgggtgtc
ggccccaagtcggcccagcgcatggcgtttaccctgctcgagcgtgagcgcagcggcggc
ctgcggctggcccagctgctctctcgcgccttgaccgagattggccactgcagccactgc
cgcaccttcaccgagaacgagcgctgcgagatctgcgccaatcccaagcgcgaagagaac
ggcctgctgtgcgtggtggagagcccggcggacgtggccgccatcgagcagaccggccag
ttctccggccgttacttcgtgctgatggggcacctctcgccgctggacggcattggcccg
gaagagctggggctggagatcctggagcgacggttgaaagacgaggcgatcagcgagctt
attctggccaccaaccccaccatcgaaggggacgccaccgcctggtacatcgccgacatg
gcccgcgccgctggcgtcaaggtgagccggattgcccacggggtgccggtgggtggcgag
ctggagctggtggacggcaccacgctctcccactccctgatggggcgtcagcccctcaac
tga

DBGET integrated database retrieval system