KEGG   Aeromonas dhakensis: CK627_15275Help
Entry
CK627_15275       CDS       T05186                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
adh  Aeromonas dhakensis
Pathway
adh00061  Fatty acid biosynthesis
adh01100  Metabolic pathways
adh01212  Fatty acid metabolism
Module
adh_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:adh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CK627_15275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:adh01004]
    CK627_15275
Enzymes [BR:adh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CK627_15275
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     CK627_15275
Lipid biosynthesis proteins [BR:adh01004]
 Fatty acid synthase
  Component type
   CK627_15275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ASX12046
UniProt: K1JPZ3
LinkDB All DBs
Position
3277525..3278085
Genome map
AA seq 186 aa AA seqDB search
MTVDNSTIDARLSLCEQGKDSFTREELLACSRGELFGEGNSQLPAPNMLMMDRIVKINDH
GGEHGKGEILAELDITPDLWFFDCHFPGDPVMPGCLGLDAMWQLVGFFLGWKGGPGKGRA
LGVGEVKFTGQILPTAKKVTYKITFKRVINRKLVMGIADGVVEVDGRPIYSATDLKVGLF
KDTTAF
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtagacaattccaccattgatgcccgcctttccctgtgtgaacaaggcaaagac
tcgtttacccgtgaagagctgctcgcctgcagccgtggcgagctgtttggtgagggcaac
agccagctgcccgcccccaacatgttgatgatggatcgcatcgtcaagatcaatgaccat
ggtggtgagcacggtaaaggtgagatcctggcagaactcgacatcacgccggatctctgg
ttcttcgattgccacttcccgggtgatcccgtcatgcctggctgtctcggtctggatgcc
atgtggcagctggttggttttttcctcggctggaaaggtggcccaggcaagggtcgtgcg
ctgggggttggcgaggtgaaattcaccggtcagatcctgccgactgccaagaaagtaacc
tacaagattaccttcaagcgcgtcatcaatcgcaagttggtgatgggaattgccgatggc
gtggtggaagtggatggtcgccccatctacagcgccaccgacctgaaagtgggcctgttc
aaggacaccaccgcattctga

DBGET integrated database retrieval system