KEGG   Aeromonas dhakensis: CK627_15300
Entry
CK627_15300       CDS       T05186                                 

Definition
(GenBank) bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
adh  Aeromonas dhakensis
Brite
KEGG Orthology (KO) [BR:adh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:adh03009]
    CK627_15300
Enzymes [BR:adh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     CK627_15300
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     CK627_15300
Ribosome biogenesis [BR:adh03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CK627_15300
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_25 Methyltransf_31 Methyltransf_11 MTS Methyltransf_15 N6_Mtase Pep_deformylase LZ3wCH
Other DBs
NCBI-ProteinID: ASX13505
LinkDB
Position
complement(3282386..3284527)
AA seq 713 aa
MSVMKEFFATCPKGLENLLAVELTNLGAEQVRETVAGVHFCGELAIGYKACLWSRFASRI
VLVLSEFQMNDDLDLYLGAHTIPWEEHFSGTATIAVDFTGTNASIRNTQYGALKIKDAIV
DRFTKRGHVRPDVDKKSPDIRIMAHLGKGKANITLDLSGPALHQRFYRQGTGEAPLKENL
AAAMIARSGWAGEPMMDPMCGSGTLLIEAAFIAADMAPALRRERFGFDRWLQHDSELWQS
LMMEAQVRAKRGMQRCEVKLFGCDADSRVLLKARDNAKAAGVAHLITFKQADATALENPL
PMAAEGETRQVGMLISNPPYGERLGEFPALLEVHQALGDALRRSFQGWKVSILSASPELL
SCLRLRADKQYRLFNGALECQLRNYQIALDSVASQKEVAQDFANRLRKNLKALEKWAKKE
NLDCYRLYDADLPEYNAAIDRYQDYLVVQEYAAPKDIPAQKTRQRLLDMVQAAIKVTGMD
GEKVILKVRERQEGKQQYQKLSEEQHRMEVQEYGARLWVNLYDYLDTGLFLDHRQTRRML
GEMARGKRFLNLFAYTGSATVHAGLGGASETTTVDMSRTYLNWAQDNMRLNSLVGREHKF
VQADCLKWLSEADEQYDLIFIDPPTFSNSKRMDESFDVQRDHLLLMQHLKRLLAAGGTLV
FSNNKRHFKMDLAGLEAIGLKAQNITGKTRPKDFERNQHIHNCWIITHAEAQG
NT seq 2142 nt   +upstreamnt  +downstreamnt
gtgagcgtgatgaaagaattttttgcaacctgccccaaggggctggaaaacctgttggcc
gtcgagctgaccaatctgggtgcagagcaggtccgcgagaccgtggccggcgtccatttc
tgcggcgagctggccatcggttacaaggcctgtctgtggagccgttttgcctcccgcatc
gtgctggtgctctccgagttccagatgaacgacgatctggacctctatctgggcgcccat
accattccctgggaagagcacttctccggcaccgccaccatagcggtggatttcaccggt
accaatgcctccattcgcaacacccagtacggcgcgctcaagatcaaggacgccatcgtc
gatcgcttcaccaagcgtggtcatgtgcgcccggacgtggacaagaaatccccggacatt
cgcatcatggcccatctgggcaagggcaaggccaatatcacgctggacttgtcaggcccc
gcgctgcaccagcgcttctatcgtcagggcaccggtgaggcaccgctcaaagagaacctg
gccgcggccatgatcgcccgtagcggctgggccggtgagcccatgatggaccccatgtgc
ggttccggtaccctgctgattgaagcggcctttatcgccgccgacatggcgccggccctg
cgccgcgagcgcttcggtttcgatcgctggctgcagcatgacagcgaactgtggcaaagc
ctgatgatggaggcgcaagtgcgcgccaaacgcggcatgcagcgctgcgaggtgaagctg
ttcggttgtgatgccgactcccgcgtgctgctcaaagcccgtgacaacgccaaagccgcc
ggcgtggctcatctcatcaccttcaaacaggccgatgcgaccgccctggaaaacccgctg
cccatggcggcggaaggggagacccgtcaggtcggcatgctcatttccaacccgccctat
ggcgagcgtctcggtgagttcccggcgctgctggaggtgcaccaggcccttggcgatgcc
ctgcgtcgcagcttccagggctggaaggtctcgatcctttctgcctcccccgagcttttg
agctgtctgcgcctgcgcgccgacaagcaatatcgcctgttcaacggggcgctcgagtgt
cagctgcgcaactaccagatcgcgctggactccgtggcctcccaaaaagaggtggcgcag
gactttgccaaccgtctgcgcaagaatctgaaggccctcgagaagtgggcgaagaaagag
aacctagactgctaccgtctctacgacgccgatctgccggagtacaacgccgccatcgac
cgctatcaggactatctggtggtgcaggagtacgcggcgcccaaggacattcccgcccag
aagacccgtcagcgcctgctcgacatggtacaggccgccatcaaggtgaccggcatggac
ggcgagaaggtgatcctgaaggtgcgcgagcgtcaggaaggcaaacagcagtaccagaag
ctctccgaagagcagcaccggatggaggtgcaggagtacggtgcccgtctgtgggtcaac
ctctacgactatctcgacaccggcctgttcctcgaccaccgtcagacccgccgcatgctg
ggcgagatggcccgtggcaagcgcttcctgaatctctttgcctacaccggcagtgccacc
gtgcacgcgggtctgggcggtgccagcgaaaccaccacggtggacatgtcgcgcacctac
ctgaactgggcacaggacaacatgcgcctcaactcgctggtgggccgcgaacacaagttc
gtgcaggcggactgcctgaagtggctctccgaggcggacgaacagtacgacctcatcttc
atcgatccgcccaccttctccaactccaagcggatggacgagagcttcgacgtgcagcgc
gatcacctgttgctgatgcagcacctcaagcgtctgctggctgcgggtggcaccctggtc
ttctccaacaacaagcgccacttcaagatggatctggccggtctcgaggccatcggtctc
aaggcccagaacatcaccggcaagacccggccgaaggatttcgagcgcaaccagcatatc
cacaactgctggatcatcacccatgccgaggcccagggctga

DBGET integrated database retrieval system