KEGG   Aeromonas dhakensis: CK627_16415Help
Entry
CK627_16415       CDS       T05186                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
adh  Aeromonas dhakensis
Pathway
adh00020  Citrate cycle (TCA cycle)
adh00190  Oxidative phosphorylation
adh00650  Butanoate metabolism
adh01100  Metabolic pathways
adh01110  Biosynthesis of secondary metabolites
adh01120  Microbial metabolism in diverse environments
adh01130  Biosynthesis of antibiotics
adh01200  Carbon metabolism
Module
adh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
adh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
adh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:adh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CK627_16415 (sdhB)
   00650 Butanoate metabolism
    CK627_16415 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CK627_16415 (sdhB)
Enzymes [BR:adh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CK627_16415 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     CK627_16415 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_9 Fer4_7 Fer4
Motif
Other DBs
NCBI-ProteinID: ASX12250
UniProt: A0A433GDE9
LinkDB All DBs
Position
complement(3539900..3540616)
Genome map
AA seq 238 aa AA seqDB search
MNVTFSVYRYNPDVDNVPHMKEYRLDIPEGSDMMVLDALIQLKELDPTLAFRRSCREGVC
GSDGLNMNGKNGLACITPLSDLLKKGNNVVIRPLPGLPVIRDLVIDMTQFYTQWEKVKPF
LINDEKLPPVREHLQSPEERAKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
WLADSRDTAATERLGNLDDAFSVFRCHGIMNCVNVCPKGLNPTKAIGHIKSMLLNRAV
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcacattctctgtctacagatacaatccggatgttgataacgtcccccatatg
aaggaatatcgtcttgatattcctgaaggttccgacatgatggtgctcgacgcactgatc
cagctcaaggagctggatcccacgctcgccttccgccgctcctgccgcgaaggggtttgt
ggatcagacggtctcaacatgaatggcaagaacggtcttgcctgcatcaccccgctctcc
gatctgctgaagaagggcaataacgtcgttatccgccccttgccaggcctgccggtgatc
cgcgatctggtgatcgacatgacccagttctacacccagtgggagaaggtcaaacccttc
ctcatcaacgacgaaaaattgccgcccgtgcgtgagcacctgcaatcccccgaagagcgc
gccaagctggatggcctgtacgagtgcatactctgtgcctgctgctccacctcttgcccc
tccttctggtggaacccggacaagttcatcggcccggccgggctgctcgccgcctaccgc
tggctggcggacagccgcgacaccgccgcgaccgagcgactgggtaatctggatgacgcc
ttcagtgtgttccgttgccacggcatcatgaactgcgtgaacgtctgtcccaagggattg
aacccgaccaaggccatcggccacatcaagtcgatgctgctcaaccgggctgtttga

DBGET integrated database retrieval system