KEGG   Aeromonas dhakensis: CK627_19145
Entry
CK627_19145       CDS       T05186                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
adh  Aeromonas dhakensis
Brite
Enzymes [BR:adh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CK627_19145
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-ProteinID: ASX12747
UniProt: K1KC84
LinkDB
Position
4139857..4140441
AA seq 194 aa
MAFELPALPYAINALEPHISQETLEYHHGKHHNTYVVNLNNLVPGTEFEGKSLEEIIKTS
TGGIFNNAAQIWNHTFYWHCLSPNGGGEPTGALADAITKAFGSFAEFKDAFTKSAIGNFG
SSWTWLVKKADGSLAIVNTSNAGCPLTEAGTTPLLTVDLWEHAYYIDFRNLRPKYMETFW
ALVNWEFVAKNLAA
NT seq 585 nt   +upstreamnt  +downstreamnt
atggcattcgaacttcccgctctgccctatgcaatcaatgctctggaaccgcacatctcc
caggaaactctggaataccaccacggcaagcaccacaacacctacgtggtcaacctgaac
aacctggtgccgggtaccgagtttgaaggcaagtctctggaagagatcatcaagacctcc
actggtggcatcttcaacaacgccgcccagatctggaaccacaccttctactggcactgc
ctctccccgaacggcggtggcgagcccactggcgccctggccgatgccatcaccaaggcc
ttcggctctttcgccgagttcaaggatgcgttcaccaagtctgccatcggcaacttcggc
tccagctggacctggctggtgaagaaggctgacggctctctggccatcgtcaacacctcc
aacgccggttgcccgctgaccgaagccggtaccaccccactgctgaccgtcgacctgtgg
gagcacgcctactacatcgacttccgcaacctgcgtccgaagtacatggaaaccttctgg
gccctggtcaactgggaattcgtggccaagaacctggctgcctga

DBGET integrated database retrieval system