KEGG   Aeromonas dhakensis: CK627_19645
Entry
CK627_19645       CDS       T05186                                 

Definition
(GenBank) crossover junction endodeoxyribonuclease RuvC
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
adh  Aeromonas dhakensis
Pathway
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CK627_19645
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_19645
Enzymes [BR:adh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     CK627_19645
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CK627_19645
    RecFOR pathway proteins
     CK627_19645
SSDB
Motif
Pfam: RuvC DUF3882
Other DBs
NCBI-ProteinID: ASX12835
LinkDB
Position
complement(4254479..4255000)
AA seq 173 aa
MSIILGIDPGSRITGYGVIRIVAGKAEYLGSGCIRTDLGELPSRLKQVYDGVSEIITQFK
PDEFAIERVFMARNADSALKLGQARGSAIVAAVNALLPVSEYSATQIKQAVVGTGGAAKE
QVQHMVTHLLKLSATPQADAADALGVALCHFHTRQILIKMAGRSTGSVRGRYR
NT seq 522 nt   +upstreamnt  +downstreamnt
atgagcattattttggggatagatccgggttcacgcatcacaggttacggggtcattcgc
atcgtggcgggcaaggcggagtacctgggctcgggctgcatccgcaccgacctgggggaa
ctgccgtcgcgcctcaagcaggtctatgacggggtgagcgagatcatcacccagttcaag
ccggacgagttcgccatcgagcgggtctttatggcgcgcaatgccgattccgctttgaag
ctgggtcaggctcgcggcagcgccatcgtggcggcggtcaatgccctgctgccggtgagc
gaatactcggccacccagatcaagcaggcggtggtgggcaccggcggcgccgccaaggag
caggtgcagcatatggtgacccacctgctcaagctctcggccaccccccaggcggatgcg
gcggatgccctcggggtggcgctctgccacttccatacccgccagatcctgatcaagatg
gctggacgcagcacgggatcggtgcgcggtcgctaccgctga

DBGET integrated database retrieval system