KEGG   Aeromonas dhakensis: CK627_21955
Entry
CK627_21955       CDS       T05186                                 

Definition
(GenBank) hypothetical protein
  KO
K02317  DNA replication protein DnaT
Organism
adh  Aeromonas dhakensis
Pathway
adh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CK627_21955
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:adh03400]
    CK627_21955
DNA repair and recombination proteins [BR:adh03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CK627_21955
SSDB
Motif
Pfam: DnaT
Other DBs
NCBI-ProteinID: ASX13261
LinkDB
Position
4765359..4766036
AA seq 225 aa
MTPAEYSALAHPRLSHPARSLYTLQLRRLVLENQLARLNYPELGRALAVVDPGDPSGFSF
QVNARQLTELFDELMEAGLLQVESQTESEHYHQCPFQLPLLTQRVRSPLPERPFQMHLQW
RPDEELSALARLCGVIDASYSEEDLGEFIAYWLGRPEVFDSQHQWMLKFIRALKTRRYAR
RQPMSVTGYQQVTPEPVEAGPSKRAQEMIEEAKRLAAQRQDPDND
NT seq 678 nt   +upstreamnt  +downstreamnt
atgaccccagccgaatacagcgctctcgcccaccccagattgtcccaccctgcccgcagc
ctctataccctgcagttgcgtcggctggtgctggaaaatcagctggccaggctcaactac
ccggagcttgggcgggcgctggcagtggtcgatccgggcgatcccagcggcttctccttt
caggtcaatgcccgccagctgaccgaactgtttgacgagctgatggaggccggcctgctg
caggtcgagagccagaccgagagtgagcactaccatcagtgtccgttccagttgccgctg
ctgacccagcgggtgcgcagccccctgccggagcgccccttccagatgcacctgcagtgg
cgcccggatgaagagttgtccgccctcgcccgcctgtgcggtgtgatcgatgccagctac
agcgaagaggatctcggcgagttcatcgcctactggctggggcggcccgaggtgttcgac
tcccagcatcagtggatgctcaagttcattcgcgccctcaagacccgccgttacgcccgc
cgtcagccgatgagcgtaaccggctatcagcaagtcaccccggagccggtggaggcgggc
ccgagcaagcgggcgcaggagatgatcgaagaggccaagcggctggccgcgcagcgccag
gatccggataatgattga

DBGET integrated database retrieval system