KEGG   Alcanivorax dieselolei: B5T_02125
Entry
B5T_02125         CDS       T02259                                 

Definition
(GenBank) Putative membrane protein
Organism
adi  Alcanivorax dieselolei
SSDB
Motif
Pfam: DUF4400 Flp1_like
Other DBs
NCBI-ProteinID: AFT70399
UniProt: K0CA19
LinkDB
Position
complement(2319882..2320595)
AA seq 237 aa
MAETTAQSTQSRHGRRTPPGLLSRLLGLPFRIVAVLVFSIISAVLIEWAGMAFQWWEQPG
AEHALHMMHTEVGWLDSHFTQSLLLSNPVVTVQAAVNAAFDTVLIKTGIGPALMQYSNES
GWLGTVATYLLAAVYIALVILVRAVILFLTFPLFVMAALVGFVDGLVRRDLRKFGAGRES
AFIYHHAKRWAGPVFVTGWLLYLSVPWSIHPNTFLLPCASLFGLIVSITAGSFKKYL
NT seq 714 nt   +upstreamnt  +downstreamnt
atggcggaaacgacggctcaatcaactcaatccaggcacggccgccgcacgccgcctggt
ctgctgtcccggctgctggggctgccgttccggatcgttgcggtcctggtgttctccatt
atctcggcggtcctgatcgaatgggcggggatggcgttccagtggtgggagcagcccggg
gccgagcatgcgctacacatgatgcatacggaagtcggctggttggacagccattttacg
caatcactgttgctgtccaacccagtggtgacagtacaagccgccgtgaacgcggccttc
gataccgttctgattaaaaccggcattggacccgcgctgatgcagtattccaatgaatcc
ggctggctgggtaccgtggcgacctacctgttggccgccgtctatatcgcgctggtgatc
ctggtacgcgccgtcattctatttttgacctttccgctgttcgtgatggcggcgctggtg
gggtttgtggacgggctggttcgtcgtgatctgcgtaagttcggcgcgggaagagagagt
gcctttatctatcaccacgccaagcgctgggccgggccggtgttcgtcaccggctggtta
ctctatctgagtgtcccctggtccatccatccgaatacctttttattgccctgtgccagc
ctgtttgggctgatcgtcagtatcactgccgggtcattcaaaaaatatctctag

DBGET integrated database retrieval system