KEGG   Alcanivorax dieselolei: B5T_03975Help
Entry
B5T_03975         CDS       T02259                                 

Definition
(GenBank) Penicillin-binding protein, putative
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00550  Peptidoglycan biosynthesis
adi01100  Metabolic pathways
adi01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:adi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B5T_03975
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    B5T_03975
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:adi01003]
    B5T_03975
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:adi01011]
    B5T_03975
Enzymes [BR:adi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     B5T_03975
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     B5T_03975
Glycosyltransferases [BR:adi01003]
 Polysaccharide
  Bacterial polysaccharide
   B5T_03975
Peptidoglycan biosynthesis and degradation proteins [BR:adi01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   B5T_03975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AFT72236
UniProt: K0CKY5
LinkDB All DBs
Position
4405396..4407921
Genome map
AA seq 841 aa AA seqDB search
MAGSYLYLAPQLPDAIGIREVEYQTPLRIYSSDEKLMAEYGEKRREPVTFDHLPPLFVQA
VLAAEDERFFRHAGVDVKGLARAAVELIRYREIRSGGSTITMQVARNFFLDREQRFLRKF
NEIVLAMQIENILTKEQILELYLNKIYLGHRSYGAQAAAKVYYGKDIGELTLPQLAMIAG
LPKAPSAYNPITNPERAVQRRNWILGRMHETGAITEEQMEQARQAPVTARYHTSRPEVEG
AYVAEMARLAVADIIPGDLYTQGLRVITTVDSKRQEAAVRALREGLHEYDERHGYRGPLA
EVDTGSLPELTWPQGDEAEAAPEDEAPQPELARPEEEDQEGLGNDVVAWLDTFKDQPAYG
PLRTAIVTEIREDAAAVLLGDGKQAVVAWKDISWARPALRKGYVGEKPKQVADVLKVGNV
IYLRPVNDKNGAHWRLAQLPQAQSALVSLDPETGALQALQGGYSFAASNFNRAMQGQRQA
GSVFKPFVYTAALENGFTPATIINDAPVVYDSAELGKAWRPKGSSGRFYGPTRMREALYR
SLNLVSIRILRQVGIEQTMETLKEFGLPYDRFQRDLSLALGSGSLTPLELATAYAMFANG
GYRVAPWYIDRIEDRDGHVLWRAPEVLRCDLPCADERARIATEEAAWEQREQLPTLLERE
EVSLGNNNRDDQPPETLQPPPVLAPRTLDPEVAWLMNSMLQDVIKRGTGRQASSLGRKDL
AGKTGTTNNHVDAWFSGYAPSLVTTVWVGLDTPTSLGWGEYGGRAALPIWTSYMGKALDG
VPETSLRQPPGIVSVRIDPKSGLVARSGNSNAIFEYFREDDVPEQESPYNGGSGGSPEQI
F
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atggccggctcctatctgtacctggcgccgcaactgcctgatgccattggcattcgcgag
gtcgaataccagacgccgctgcgtatctacagcagcgacgagaaactcatggccgaatac
ggcgagaagcgccgcgagccggtcacctttgaccatctgccgccgctgttcgtccaggcg
gtactggcggcggaagacgagcgcttcttccgccacgccggggtggacgtgaaagggctg
gcccgggccgcggtggagttgatccgctatcgcgagatccgttccggcggttccaccatc
accatgcaggtggcgcgcaacttctttctcgaccgggaacagcgcttcctgcgcaagttc
aacgagatcgtgctggccatgcagatcgagaacatcctgaccaaggagcagattctcgag
ctgtatctcaacaagatctatctgggtcaccgctcctacggcgcccaggccgcggccaag
gtctactacggcaaggacatcggcgaactgaccctgccgcagctggcgatgatcgccggc
ctgccgaaggcgccttccgcctacaacccgatcaccaacccggagcgggcggtacagcgc
cgtaactggattctcggccgcatgcacgaaaccggcgccattaccgaagagcaaatggaa
caagcccggcaggcgccggtgaccgctcgctatcacacctcacgaccggaagtggaaggc
gcctatgtggcggagatggcgcgcctggcggtggccgatatcatccccggcgacctctac
acccagggtttacgggttatcaccacggtcgacagcaaacgtcaggaagcggcggtacgc
gccctgcgtgaaggcctgcacgaatacgatgaacgccacggctatcgcgggccgctggcc
gaggtggacaccggctccctgccggagctgacctggccccagggcgacgaggcggaggcc
gcccccgaggatgaggcgccgcagccggagctggcccgcccggaggaggaggatcaggaa
ggcctgggcaacgacgtggtcgcctggctcgacaccttcaaggaccagcccgcttacggt
ccgctgcgcaccgccatcgttaccgagatacgggaagacgccgccgcggtgctgttgggc
gacggcaaacaggctgtggtggcctggaaggatatcagttgggcgcgcccggcattgcgc
aagggttatgtcggggaaaaacccaagcaggtcgccgatgtcctcaaagtcggcaatgtc
atctacctgcgcccggtgaatgacaagaacggcgcccactggcggctggcgcaactgccc
caggcgcaatccgcactggtgtcactggatccggaaaccggcgctctgcaggcactgcag
ggcggctacagcttcgccgcctccaacttcaaccgggcgatgcagggccagcgccaggct
ggttcggtgttcaagccgtttgtttacaccgcggcactggaaaacggtttcaccccggcc
accatcatcaatgacgccccggtggtctacgacagcgccgagctgggcaaggcctggcgg
ccgaaaggctccagcggccgcttctatggccccacccgcatgcgtgaagcgctgtaccgt
tctctcaacctggtatcgatccgcattctccgccaggtgggcatcgaacagaccatggag
actctgaaagagtttggcctgccctatgatcgtttccagagggacctgtccctggccctg
ggcagcggatcgctgacgccgctggaattggccaccgcttacgccatgttcgccaacggc
ggttaccgggtggccccctggtatattgatcgtatcgaagaccgcgacggccatgtgctg
tggcgcgcaccggaagtgctgcggtgtgatctgccctgcgccgatgaacgagcccgaatc
gccaccgaggaagcggcctgggaacaacgcgaacaactgcccacgctgctggagcgcgag
gaagtcagcctcggcaacaacaaccgcgatgatcagcccccggaaacattgcaaccgccg
ccggtgctggcgccccgcaccctggatccggaggtggcctggttgatgaactccatgctg
caggacgtgatcaagcgcggcaccggccgccaggcaagctcccttggccgcaaggatctg
gccggcaagaccggcaccaccaacaaccatgtggatgcctggttctccggctatgcgccg
agcctggtaaccaccgtgtgggtgggactggacacgccgacctccctgggctggggcgaa
tacggcggccgtgccgccctgccgatctggaccagctacatgggcaaggcgctggatggc
gtcccggaaacctccctgcgccagcctccgggtattgtctcggtccgcattgatccgaag
agcggcctggtcgctcggtccggcaacagcaatgccatcttcgagtatttccgcgaagac
gacgtgccggaacaggagagcccctataacggcggcagcggcggcagtccggaacagatt
ttctga

DBGET integrated database retrieval system