KEGG   Alcanivorax dieselolei: B5T_04099Help
Entry
B5T_04099         CDS       T02259                                 

Gene name
ahpF-1
Definition
(GenBank) Alkyl hydroperoxide reductase, subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
adi  Alcanivorax dieselolei
Brite
KEGG Orthology (KO) [BR:adi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B5T_04099 (ahpF-1)
Enzymes [BR:adi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     B5T_04099 (ahpF-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored DAO Glutaredoxin Thi4 FAD_binding_3 AlaDh_PNT_C K_oxygenase NAD_binding_8 FMO-like Cytochrom_C_2
Motif
Other DBs
NCBI-ProteinID: AFT72359
UniProt: K0CFT0
LinkDB All DBs
Position
complement(4544501..4546072)
Genome map
AA seq 523 aa AA seqDB search
MLDANLKTQLQSYMERITQPFEMVASLDDGDKSRELSELLRDIEAMSDKITLREDGDDER
RPSFSLNRVDGDISLRFAGIPMGHEFTSLVLALLQVGGHPPKVSDEVIEQVQALQGDFRF
ETYFSLSCQNCPDVVQALNLMAVLNPNIKHVAIDGALFQDEVDQRQVMAVPSVFLNGEEF
GQGRMGLEEILAKLDTGAAERDAEKLNAKEAFDVLVVGGGPAGAASAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVKETEGPKLATALEQHVRDYDVDIMNLQRAQQLIPAASEGG
LHEVRFASGASLKTKTLILATGARWREVNVPGEKEYRGRGVAYCPHCDGPLFKGKSVAVI
GGGNSGVEAAIDLAGIVEHVTLLEFDTKLRADAVLQKKLHSLANVTVHVNAQTTEITGDG
TKVNGLLYKDRDSGEEHRVELAGVFVQIGLVPNTDWLKGTVELSRHGEIITDARGETSIP
GIYAAGDVTTVPYKQIVIAMGEGAKAALSAFDHLIRTSVSDAA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaacttgaaaacccaattgcaatcctacatggagcgcatcacgcaaccg
ttcgagatggtcgcgtccctggatgatggcgacaaatcccgggagctgtcggagctgctg
cgcgacatcgaggcgatgtccgacaagatcacgttgcgtgaggatggcgatgacgagcgc
cggccctcattcagcctgaaccgtgtggacggtgacatcagcctgcgcttcgccggtatt
cccatgggccatgaattcacctctttggtgctggcactgttgcaagtgggtggccatccg
cccaaggtcagcgacgaggtgatcgagcaagtgcaagcgctgcaaggcgacttccgcttc
gaaacctatttctctctgtcctgccagaactgcccggacgtggtccaggcgttgaatctg
atggcagtactgaatccgaacatcaaacacgtggccatcgacggcgccctgttccaggac
gaagtcgatcagcgccaggtgatggcggtgcccagcgtgttcctgaacggcgaggaattc
ggccagggccgcatggggttggaggaaatcctcgccaaactggacaccggcgccgccgag
cgtgacgccgagaaactgaacgccaaggaggccttcgatgtgctggtggtgggcggtggg
cccgccggtgccgccagtgccatctacgccgcccgtaaaggcatccgcaccggtgtcgcc
gccgagcgtttcggtggtcaggtgctggataccatggcgatcgagaacttcatctcggtg
aaggaaaccgagggcccgaaactggccaccgcgctggagcagcacgtccgtgattacgat
gtggacatcatgaatctgcagcgcgcgcagcaactgattccggcggccagcgaaggcggc
ttgcatgaagtccggttcgcctccggtgccagcctcaaaacgaaaacgctgattctggcc
accggcgcccgctggcgtgaagtgaacgtgcccggtgagaaagagtaccggggacgcggc
gtggcgtactgcccgcactgcgacggtccgctgttcaaaggcaagagcgtggcggtgatc
ggcggcggtaactccggcgtggaagcggccatcgatctggccggcatcgtcgagcacgtc
actctgctggagttcgacaccaagctgcgcgccgatgccgtgctgcagaagaaactgcac
agcctggccaacgtcaccgtgcacgtgaacgcccagaccaccgagatcaccggtgatggc
accaaagtgaacgggctgctgtacaaggatcgtgacagtggcgaagagcaccgcgtggaa
ctggccggggtgttcgtgcagatcggcctggtgcccaacaccgactggctgaagggcacg
gtggagctgtcccgccacggtgagatcatcaccgacgcccgcggcgagacgtctatcccg
ggcatctacgccgccggcgacgtcaccacggtgccgtacaagcagatcgtcattgccatg
ggcgaaggggccaaggccgcgctgagcgccttcgaccacctgatccgcacctcggtgagt
gacgccgcctga

DBGET integrated database retrieval system