KEGG   Alicycliphilus denitrificans K601: Alide2_0050Help
Entry
Alide2_0050       CDS       T01463                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:adk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Alide2_0050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:adk02000]
    Alide2_0050
Enzymes [BR:adk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Alide2_0050
Transporters [BR:adk02000]
 Other Transporters
  Pores ion channels [TC:1]
   Alide2_0050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_2 GST_C_3 GST_N_3 GST_N GST_N_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AEB82490
UniProt: F4GBZ6
LinkDB All DBs
Position
complement(62750..63358)
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSLSPHIVLHEAGLAYEPVLASTKTHKLADGTDFYSINPLGYVPVLELDDG
TRLREGPAIVQYLADQAPQKNLAPAPGTLARYRLQEWLSFIGTEVHKGFGPLFAPGTPEE
YKPQLKQRLLSRLQWVDGELAGKQYLMGDHFTVADAYLFTVTNWAQFVGLDISQLKNLAA
YRERIGARPAVQAAMKAEGLLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtactactcccctggcgcctgctcgctctcgccccacatcgtgctgcacgaa
gccggcctagcctacgagcccgtgctggccagcaccaagacgcacaagctggccgacggc
accgacttctacagcatcaaccccctgggctacgtgccggtgctggagctggacgacggc
acgcgcctgcgcgagggcccggccatcgtgcagtacctggccgaccaggcgccgcagaag
aacctggcccctgcccccggcacgctggcgcgttaccgcctgcaggaatggctgtccttc
atcggcaccgaggtgcacaagggcttcgggccgctgttcgcacccggcacgccggaggag
tacaagccccagctcaagcagcgcctgctgtcccggctgcagtgggtcgacggcgaactc
gcgggcaagcagtacctgatgggcgatcatttcaccgtggcagacgcctacctgttcacc
gtgaccaactgggcgcaattcgtcggcctggacatctcgcaactgaagaacctggccgcc
taccgcgaacgcatcggcgcccgccccgcagtacaggccgccatgaaggcggagggtctg
ctcaagtaa

DBGET integrated database retrieval system