KEGG   Alicycliphilus denitrificans K601: Alide2_0133Help
Entry
Alide2_0133       CDS       T01463                                 

Definition
(GenBank) hypothetical protein
Organism
adk  Alicycliphilus denitrificans K601
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TctC PAC4 OpuAC
Motif
Other DBs
NCBI-ProteinID: AEB82571
UniProt: F4GDI8
LinkDB All DBs
Position
149904..150902
Genome map
AA seq 332 aa AA seqDB search
MPPCNRRRALHLTGACALLALGALATAPAARADAAWPTRPITFVIPGAAGGTTDTPARFM
AQKLGERLGQPIVVDNKPGAGGMLGAGLVARAQPDGYTVLVGNTGSNAINYSAYQKLGYK
PDDFIALTDMISFANVLVVPVKSPIKSLGELVAAAKKEPGKLAFSSAGVGQTTHLMGELL
RQRAGVDVVHVPYKGSAPATMAIVSGETQFMFDNLTGSLAHVKDGKLRALAVTGATREPE
LPDVPTMTELGMKDFDKVGWMGFFLPAKTPPEIVKKLTDNLVAVLKDPAVVQRYRELGGR
RGGMASAQFSQMVERDRKDWGELIRSQKLQLD
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcccccgtgcaaccgccgccgcgcgctccatctgaccggggcatgcgccctgctggcg
ctgggcgccctggcgacggccccggccgcccgggccgatgccgcctggccaacgcgcccc
atcaccttcgtcatccccggcgccgccggcggcaccaccgacacgccggcgcgcttcatg
gcgcaaaagctgggcgagcgcctgggccagcccatcgtggtggacaacaagcccggcgcg
ggcggcatgctgggcgctggcctggtggcgcgcgcccagcccgacggctacaccgtgctg
gtgggcaacaccggctccaacgccatcaactacagcgcctaccagaagctcggctacaag
ccggacgacttcatcgcgctgaccgacatgatctcgttcgccaacgtgctggtggtgccg
gtgaagtcgcccatcaagagcctgggcgagctggtcgcggccgcgaagaaggagccgggc
aagctggcgttttcgtcggcgggcgtgggccagaccacgcacctgatgggcgagctgctg
cgccagcgcgcgggggtggacgtggtccacgtgccctacaagggctccgcgccggccacc
atggccatcgtgtccggcgagacccagttcatgttcgacaacctcacgggctcgctcgcc
cacgtcaaagacggaaagctgcgcgcgctggccgtgaccggcgccacgcgcgagcccgag
ctgcccgacgtgcccaccatgaccgagctgggcatgaaggacttcgacaaggtaggctgg
atgggcttcttcctgcccgccaaaacgcccccggagatcgtgaagaagctcaccgacaac
ctggtcgccgtactcaaggacccggccgtggtccagcgctaccgcgagctcggcggccgc
cgcggcggcatggcgagcgcgcagttctcgcagatggtggagcgcgaccgcaaggactgg
ggcgagctcatccgcagccagaagctgcagctcgattga

DBGET integrated database retrieval system