KEGG   Alicycliphilus denitrificans K601: Alide2_1335Help
Entry
Alide2_1335       CDS       T01463                                 

Definition
(GenBank) Malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+))
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00620  Pyruvate metabolism
adk01100  Metabolic pathways
adk01120  Microbial metabolism in diverse environments
adk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:adk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Alide2_1335
Enzymes [BR:adk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     Alide2_1335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M AlaDh_PNT_C Malate_DH ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: AEB83739
UniProt: F4GDS2
LinkDB All DBs
Position
complement(1396950..1399259)
Genome map
AA seq 769 aa AA seqDB search
MTSPLSAAEQALREAALEYHRSPTKGKVSVAPTKPLSNQRDLSLAYSPGVAYPCLDIQAD
PTKAFDYTSRGNLVGVITNGTAVLGLGDIGPLAGKPVMEGKGCLFKKFAGVDVFDIELDA
RDPDKIIEIVASLEPTLGGINLEDIKAPECFYIERELSKRMNIPVFHDDQHGTAIISSAA
LLNGLELVGKQIDKVKVAVSGAGAAAIACVDVMVGLGVKREHIFMVDSKGVIYEGRPGGM
DESKARYAQKTDARTLADVVHGADVFLGCSAPGVLTAEMVKTMADKPIILALANPEPEIR
PELAKAVRPDCIIATGRSDYPNQVNNVLCFPYIFRGALDCGATKITEAMKLACVRQIAAL
AKENISEEVAAAYAGKELAFGPDYLIPTPFDSRLILKIAPAVAQAAAESGVATRPVADLE
VYRNSLTRFVYQTGMLMRPVINAAKAQPDAHKRVAYADGEDERALRAAQIAIDDRIARPI
LIGRPAVIAARIAKAGLRMQPGKDVEICDPSDDPRFRQYWEAYHQLMKRNGATPEMAKAA
VRRSNTIIAALMVRLGDADAMICGLVGTYETHLERIHNILGHAADAKQYAALNAVMTPHN
GTLFIADTYVNEDPTAEELADIAWAAVQEVQRFGLPPKVAFLSHSSFGSSKRSSARKMRA
ARDLFVARHPDIECDGELHGDAALEPRIRANYLQDSTLTGAANLLICPNLDSANILYNVL
KTTTSGGVTVGPILMGTAATAYILTPASTVRRVLNMTALAVVSSATRRQ
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgcccctgtctgccgccgaacaagccctgcgcgaagccgcactcgaataccac
cgcagccccaccaagggcaaggtctcggtcgccccgaccaagccgctctccaaccagcgc
gacctgtccctcgcctactcgcccggcgtggcctatccctgcctggacatccaggccgac
cccaccaaggcattcgactacacctcgcgcggcaacctggtgggcgtgatcaccaacggc
acggcggtgctgggcctgggcgacatcgggccgctcgcgggcaagccggtgatggagggc
aaggggtgcctgttcaagaagttcgcgggcgtggacgtgttcgacatcgagctggacgcg
cgcgaccccgacaagatcatcgagatcgtcgcgtcgctcgaacccacgctgggcggcatc
aaccttgaggacatcaaggcgcccgagtgcttctacatcgagcgcgaattgtccaagcgc
atgaacatcccggtgttccacgacgatcagcacggcacggccatcatttcgagcgccgcg
ctgctcaacggcctggagctcgtgggcaagcagatcgacaaggtgaaggtggccgtctcc
ggcgccggcgccgcggccatcgcctgtgtggacgtgatggtcggcctgggcgtgaagcgc
gagcacatcttcatggtggactccaagggcgtgatctacgagggccgccccggcggcatg
gacgaatccaaggcccgctacgcgcagaagaccgatgcgcgcacgctggccgacgtggtc
catggggccgacgtattcctgggctgctcggcccccggcgtgctcacggccgagatggtc
aagaccatggcggacaagcccatcatcctggcgctggccaaccccgagcccgagatccgc
cccgagctcgccaaggccgtgcgcccggactgcatcatcgccacgggccgctcggactat
cccaaccaggtgaacaacgtcctgtgcttcccctacatcttccgcggcgcgctggactgc
ggggccaccaagatcaccgaggccatgaagctcgcctgcgtgcgccagatcgccgcgctc
gccaaggagaacatcagcgaggaagtggccgccgcctacgccggcaaggaactcgccttc
ggccccgactacctgatccccactccgttcgactcccgcctgatcctcaagatcgcaccg
gcggtggcgcaggcggcggcggaatcgggcgtcgccacgcgcccggtcgccgacctggag
gtctacaggaacagcctgacgcgcttcgtgtaccagaccggcatgctgatgcgccccgtc
atcaacgcggccaaggcccagcccgatgcgcacaagcgcgtggcctacgccgacggcgag
gacgagcgcgcgctgcgcgcggcgcagatcgccatcgacgaccgcatcgcgcgccccatc
ctcatcggccgccccgccgtgatcgcagcgcgcatcgccaaggccggcctgcgcatgcag
ccgggcaaggacgtggagatctgcgacccctcggacgatccgcgcttccgccagtactgg
gaggcctaccaccagctcatgaaacgcaacggcgccacgcccgagatggccaaggccgcc
gtgcgccggtccaacaccatcatcgccgcgctcatggtccggctcggcgacgcggacgcg
atgatctgcggcctggtgggaacgtacgagacgcacctggagcgcatccacaacatcctg
ggccacgccgcggatgcgaaacagtacgccgccctgaacgccgtgatgaccccccacaac
ggcacgttgttcatcgccgacacctacgtcaacgaagacccgacggccgaagagcttgcc
gacatcgcctgggccgccgtgcaggaggtgcagcgcttcggcctgccgcccaaggtggcg
ttcctgtcgcactcgagcttcggctcgtccaagcgcagctcggcccgcaagatgcgcgcc
gcgcgcgacctgttcgtggcgcgccaccccgacatcgaatgcgacggcgagctgcacggc
gacgcggccctggagccccggatccgcgccaactatctgcaggactccacgctcaccggc
gcggccaacctgctgatctgcccgaacctcgactcggccaacatcctctacaacgtgctc
aagaccacgaccagcggcggcgtgaccgtgggccccatcctcatgggcaccgccgccacg
gcctacatcctcacgcccgcatccaccgtgcgccgcgtgctgaacatgacggccctggcc
gtggtgagcagcgccacgcgccggcagtaa

DBGET integrated database retrieval system