KEGG   Alicycliphilus denitrificans K601: Alide2_1529Help
Entry
Alide2_1529       CDS       T01463                                 

Definition
(GenBank) L-iditol 2-dehydrogenase
Organism
adk  Alicycliphilus denitrificans K601
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N AlaDh_PNT_C UDPG_MGDP_dh_N 2-Hacid_dh_C TrkA_N 3HCDH_N Methyltransf_25 XdhC_C NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: AEB83925
UniProt: F4GFJ3
LinkDB All DBs
Position
complement(1621651..1622721)
Genome map
AA seq 356 aa AA seqDB search
MRGIVFRGDRKLEILDFPDPTPGPGDAIVEMKASGMCGSDLHFYRNKPAEVLKSLGFKDL
ASRGMAEDTPIIAGHEPCGQIVAVGSAVDPRVFKVGDRVTVFHYEGCNHCDHCRSGWTQM
CSHGADIHGVIKHGGHAHYMKVPVTSLVHLPEEVSYATGAAISCGTGTAWGALLRLNVTA
RDTLAVFGLGPVGLSAVQLAAAMGAEVIGIDIAPDRVARAREFGAAHVIDGSKADPIEEI
LKLTGGLGATCSMDCAGGDVPKQQAVRCTRPWGRIALVAVGGNLHVDGMKDVIGKQRTIV
GSYTFSEPSMKDCVTFVARHGVQVDRLFTDHWKLEQAQEAYRVFDGQAGGKGVFVF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcatcgtattcagaggcgaccggaagctcgaaatcctcgacttccccgacccc
acgcccggccccggcgacgccatcgtcgagatgaaggcctcgggcatgtgcggcagcgac
ctgcacttctaccgcaacaagcccgccgaggtgctcaagtccctgggcttcaaggacctg
gcctcgcgcggcatggccgaggacacgcccatcatcgcgggccacgagccctgcggccag
atcgtcgcggtcggctcggccgtcgatccgcgcgtgttcaaggtgggcgaccgcgtcacg
gtgttccactacgagggctgcaaccactgcgaccactgccgcagcggctggacgcagatg
tgcagccatggcgcggacatccacggcgtcatcaagcatggcggccacgcgcactacatg
aaggtgcccgtgacttcgctggtgcatctgcccgaggaggtgtcctacgccacgggcgcg
gccatttcctgcggcacgggcacggcctggggggcgctgctgcgcctgaatgtcaccgcg
cgcgacacgctggccgtgttcggcctggggcccgtgggactgtcggccgtgcaactggcc
gcggccatgggcgcggaggtgatcggcatcgacatcgcgcccgaccgcgtggcgcgcgcc
agggagttcggcgcggcccacgtgatcgacgggagcaaggccgatccgatcgaggaaatc
ctcaagctcacgggcggcctgggcgcgacctgttccatggactgcgcgggcggcgacgtg
cccaagcagcaggccgtgcgctgcacacgcccctgggggcgcatcgcgctcgtggccgtg
ggcggcaaccttcatgtggatggcatgaaggacgtgatcggcaagcagcgcaccatcgtc
ggctcctacaccttctcggagccgagcatgaaggactgcgtgaccttcgtggcccgccac
ggcgtgcaggtggacaggcttttcaccgaccactggaagctggagcaggcccaggaggcc
taccgcgtcttcgacgggcaggccggcggcaagggcgtgttcgtgttctga

DBGET integrated database retrieval system