KEGG   Alicycliphilus denitrificans K601: Alide2_1654Help
Entry
Alide2_1654       CDS       T01463                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
adk  Alicycliphilus denitrificans K601
Brite
KEGG Orthology (KO) [BR:adk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Alide2_1654
Enzymes [BR:adk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Alide2_1654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored HI0933_like FAD_binding_3 DAO FAD_binding_2 Glutaredoxin Thi4 AlaDh_PNT_C K_oxygenase NAD_binding_8 FMO-like 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AEB84045
UniProt: F4G3Y4
LinkDB All DBs
Position
1747564..1749132
Genome map
AA seq 522 aa AA seqDB search
MLDDQLKSQLAAYLERVTQPFEMVASLDDGETSAQMRELLTTIQSLRSDKISLRTDGQDA
RKPSFTLQRVGAGTSLRFAGLPLGHEFTSLVLALLWTGGHPPKVEQDLIEQVRSLDGDFN
FEVYMSLTCHNCPDVVQALSLMAVLNPKVKTTVIEGGAFQQEVTEREIMAVPMVYLNGQV
FGAGRMELAEIVAKLDTGAARREAAKLSAKEAFDVLIVGGGPAGAAAAVYAARKGIRTGV
AAERFGGQVNDTLDIENYISIPRTEGPQFAAALQQHVNAYDVDVMNLQRAKALRPASQSG
GLIEVEMDNGAVLKSKTVILSTGARWRNMNVPGEEQYRTKGVAYCPHCDGPLYKGKRVAV
IGGGNSGVEAAIDLAGVVAHVTVFEFMPQLKADAVLQKKLASLPNVDVVLNAQTTEVLGD
GSKVNALAYKDRATGEEKRVELEGIFVQIGLLPNTDWLMGTVELSKFGEIVIDAKGQTSV
PGVFAAGDCTTVPYKQIVIAAGAGATAALSAFDHLIRTSVPQ
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgatcaactcaaatcccaactcgccgcctacctggagcgcgtgacgcaaccg
ttcgagatggtggcttccctggacgacggcgagacctcggcgcagatgcgcgaactgctc
acgaccatccagtcgctgcgcagcgacaagatcagcctgcgcaccgacggccaggatgcg
cgcaagccctcgttcacgctgcagcgcgtgggcgcgggcaccagcctgcgcttcgcgggc
ctgcccctgggccatgaattcacctcgctggtgctggcgctgctatggacgggcggccat
ccgcccaaggtggagcaggacctgatcgagcaggtgcgctcgctcgacggcgacttcaac
ttcgaggtctacatgagcctgacctgccacaactgccccgacgtggtgcaggccctgtcg
ctcatggccgtgctcaaccccaaggtcaagaccacggtgatcgagggcggcgccttccag
caggaggtgaccgagcgcgagatcatggctgtgcccatggtttacctgaacggccaggtg
ttcggcgcgggccgcatggagctggccgagatcgtcgccaagctcgacaccggcgccgcc
aggcgcgaggccgccaagctctcggccaaggaagcgttcgacgtactcatcgtcggcggc
ggcccagccggcgccgcggcggccgtgtacgcagcgcgcaagggcatccgcaccggcgtg
gcggccgagcgcttcggtggccaggtcaacgacacgctggacatcgagaactacatctcc
atcccccgcaccgagggcccgcagttcgctgccgcgctgcagcagcacgtgaacgcgtac
gacgtggacgtgatgaacctgcagcgcgccaaggcgctcaggcccgccagccagagcggt
ggcctgatcgaggtggagatggacaacggcgccgtgctgaagagcaaaaccgtcatcctc
tcgaccggcgcgcgctggcgcaacatgaacgtgcccggcgaggagcagtaccgcaccaag
ggcgtggcctattgcccgcactgcgacggcccgctctacaagggcaagcgcgtggcagtg
atcggcggcggcaactcgggcgtcgaggcggccatcgacctggccggcgtggtggcgcat
gtcacggtgttcgagttcatgccccagctcaaggccgacgccgtgctgcagaagaagctc
gccagcctgcccaatgtggacgtggtgctcaatgcccagaccaccgaggtgctgggcgac
ggcagcaaggtcaacgcgctggcctacaaggaccgggctacgggcgaggaaaagcgcgtg
gagctcgaaggcatcttcgtgcagatcggcctgctgcccaacaccgactggctcatggga
acggtggagctgtccaagttcggcgagatcgtcatcgacgccaagggccagaccagtgtg
cccggcgtgttcgccgcgggtgactgcacaacggttccgtacaagcagatcgtcatcgcc
gcgggagcgggcgccaccgccgccttgagcgccttcgaccacttgatccgcaccagcgta
ccgcaatga

DBGET integrated database retrieval system