KEGG   Alicycliphilus denitrificans K601: Alide2_1784
Entry
Alide2_1784       CDS       T01463                                 

Definition
(GenBank) integrating conjugative element membrane protein, PFL_4697 family
Organism
adk  Alicycliphilus denitrificans K601
SSDB
Motif
Pfam: DUF4400
Other DBs
NCBI-ProteinID: AEB84170
UniProt: F4G5J4
LinkDB
Position
1879414..1880163
AA seq 249 aa
MSDPAVAAQRQQQRQQGLIAGLVTLPFRFFGVLCGALLLCILIECVGMHFFWPEQGWRHA
QGMLHYELDQLSTHFTRSALVQEPGRTAHRLVEQGYDWLFVKSGLLDWIRDASAQASAGS
HRPTKDFRYYIGLVYVNVESYLIAAAYTTLVFLVRLLVLCLTLPLFLMAAFVGLVDGLVR
RDIRRFGAGRESGFIYHRARASLIPLAVLPWVTYLALPVSVNPLLILLPSAALLGVAVCI
AAATFKKYL
NT seq 750 nt   +upstreamnt  +downstreamnt
atgagcgatccggccgtcgcggcccaacgccagcagcaacgacagcaaggcctgatcgcc
ggcctggtcacgctgccgttccgcttcttcggcgtgctgtgcggcgcgctgctgctgtgc
atcctgatcgaatgcgtcggcatgcacttcttctggcccgagcagggctggcgccacgcg
cagggcatgctgcactacgagctggatcagctttccacgcatttcacccgcagcgcgctg
gtgcaggagccggggcgcaccgcgcaccggctggtcgagcagggctacgactggctgttc
gtgaaaagcggtctgctggactggatacgcgacgcctcggcgcaggccagcgccggcagc
catcgtccgaccaaggatttccgctactacatcggcttggtctatgtgaacgtggagagc
tacctgatcgcggcggcctatacgacgctggtcttcctcgtgcggctgctggtgctgtgc
ctgaccctgccgctgttcctgatggccgccttcgtcgggctggtggacggcctggtgcgc
cgggacatccgccgcttcggcgcgggacgcgagtcggggttcatctatcaccgcgccagg
gccagcctgatcccgctggccgtgctgccgtgggtgacttacctggcattgccggtcagc
gtgaacccgctgctgatcctgttgcccagtgccgcattgctcggcgtggcggtgtgcatt
gcggcggcgacgttcaagaagtatctgtag

DBGET integrated database retrieval system