KEGG   Alicycliphilus denitrificans K601: Alide2_2939Help
Entry
Alide2_2939       CDS       T01463                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00020  Citrate cycle (TCA cycle)
adk00480  Glutathione metabolism
adk01100  Metabolic pathways
adk01110  Biosynthesis of secondary metabolites
adk01120  Microbial metabolism in diverse environments
adk01130  Biosynthesis of antibiotics
adk01200  Carbon metabolism
adk01210  2-Oxocarboxylic acid metabolism
adk01230  Biosynthesis of amino acids
Module
adk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
adk_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:adk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Alide2_2939
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Alide2_2939
Enzymes [BR:adk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Alide2_2939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AEB85286
UniProt: F4G513
LinkDB All DBs
Position
complement(3070866..3073103)
Genome map
AA seq 745 aa AA seqDB search
MSTQQPTIIYTLTDEAPRLATASFLPIVRGFTSVAGINVAESDISVAARILGEFADYLTE
EQRVPNTLAELGKKTLEPDANIIKLPNISASVSQLMAAIKELQSKGYKIPDYPENPANEQ
DKEIKARYGKCLGSAVNPVLREGNSDRRAPAAVKNYAKKHPHSMGEWKQWSQTHVSHMHH
GDFYHGEKSMTLDKARDVKMELITASGKAIVLKPKVALQAGEIIDSMFMSKKALCEFYER
ELDDCKEAGILFSLHVKATMMKVSHPIVFGHCVKIYYKEAFEKHGKLFDELGINVNNGMV
DLYEKIKVLPESKREEIIRDLHACQEDRPALAMVDSAKGITNFHSPNDVIVDASMPAMIR
GGGKMWGADGKPYDCKAVMPESTFARIYQEMINFCKWHGNFDPRTMGTVPNVGLMAQKAE
EYGSHDKTFEIAEAGVANIVDLATGEVLLSQNVEQGDIWRMCQVKDAPIRDWVKLAVTRA
RNSGMPAVFWLDPYRPHENELIKKVNAYLKDHDTAGLDIQIMSQVRAMRFTLERVARGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEEN
YLRWDSLGEFLALAVSLEDLGLKTGNASAKLLAKTLDQATGKLLDENKSPSRKVGEIDNR
GSQFYLSLYWAQALAAQTEDAALAARFAPLARQLAADEARIVEELRAVQGKPADIGGYYQ
PDLAKLDAVMRPSATFNAAIASLAA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccaacaacccaccatcatctacaccctgaccgatgaagcgccgcgcctggca
acggcctcattcctgcccatcgtgcgcggcttcacgtcggtggctggtatcaacgtggcc
gagagcgacatctcggtggcggcccgcatcctgggcgagttcgcggactatctgaccgag
gagcagcgcgtgcccaacaccctggccgagctcggcaagaagacgctggagcccgacgcc
aacatcatcaagctgcccaacatcagcgcctcggtgagccagctcatggcagccatcaag
gaactgcagtccaagggctacaagatccccgactaccccgagaaccccgccaacgagcag
gacaaggaaatcaaggcgcgctacggcaagtgcctgggctcggccgtgaatcccgtgctg
cgcgagggcaactccgaccgccgcgcgcccgccgccgtgaagaactacgccaagaagcac
ccgcactccatgggcgagtggaagcagtggtcgcagacgcatgtctcgcacatgcaccac
ggcgacttctatcacggcgagaagtcgatgacgctggacaaggcgcgcgacgtgaagatg
gagctcatcacggccagcggcaaggccatcgtgctcaagcccaaggtcgcgctgcaggcc
ggcgagatcatcgactcgatgttcatgagcaagaaggcgctgtgcgagttctacgagcgc
gagctcgacgactgcaaggaggccggcatcctgttctcgctgcacgtcaaggccacgatg
atgaaggtttcgcaccccatcgtgttcggccactgcgtgaaaatctactacaaggaagcc
ttcgagaagcacggcaagctgttcgacgagctgggcatcaacgtcaacaacggcatggtc
gatctgtacgagaagatcaaggtcctgcccgagtccaagcgcgaggagatcatccgcgac
ctgcacgcctgccaggaggaccgccccgcgctggccatggtcgattcggccaagggcatc
accaacttccactcgcccaacgacgtgatcgtcgatgcctcgatgcccgccatgatccgc
ggcggcggcaagatgtggggcgcagacggcaagccctacgactgcaaggccgtgatgccc
gagtccaccttcgcgcgcatctaccaggagatgatcaacttctgcaagtggcacggcaac
ttcgacccgcgcaccatgggcaccgtgcccaacgtgggcctgatggcgcagaaggccgag
gaatacggctcgcacgacaagaccttcgagatcgcggaagccggcgtggccaacatcgtg
gacctggccaccggcgaggtgctgctttcgcagaacgtggagcagggcgacatctggcgc
atgtgccaggtcaaggacgcgccgatccgcgactgggtcaagctcgccgtcacgcgcgcg
cgcaactcgggcatgccggccgtgttctggctcgatccctatcgcccgcacgagaacgag
ctcatcaagaaggtcaacgcttacctcaaggaccacgacaccgcgggcctggacatccag
atcatgagccaggtgcgcgccatgcgcttcacgctcgaacgcgtcgcccgcggcctggac
accatctcggtcaccggcaacatcctgcgcgactacctgaccgacctgttccccatcatg
gaactgggcaccagcgccaagatgctgtccatcgtgcccctgatggccggcggcggcatg
tacgagaccggcgcgggcggctccgcgcccaagcacgtgcagcagctcgtggaggagaac
tacctgcgctgggattcgctgggcgagttcctggcgctggccgtgtcgctcgaagacctg
ggcctgaagaccggcaacgccagcgccaagctgctggccaagacgctggaccaagccacg
ggcaagctgttggacgagaacaagtcgccctcgcgcaaggtcggcgagatcgacaaccgc
ggcagccagttctacctgtccctgtactgggcccaggcactggcagcgcagaccgaggac
gccgcgctggccgccaggttcgctccgctggccaggcaactggccgctgacgaggccagg
atcgtcgaagaactgcgtgccgtgcagggcaagccggccgacatcggcggctactaccag
cccgacctcgccaagctggacgcggtgatgcgcccgagcgccaccttcaacgccgccatc
gcctcgctggccgcctga

DBGET integrated database retrieval system