KEGG   Auricularia subglabra: AURDEDRAFT_111947Help
Entry
AURDEDRAFT_111947 CDS       T03129                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
adl  Auricularia subglabra
Pathway
adl00020  Citrate cycle (TCA cycle)
adl00190  Oxidative phosphorylation
adl01100  Metabolic pathways
adl01110  Biosynthesis of secondary metabolites
adl01130  Biosynthesis of antibiotics
adl01200  Carbon metabolism
Module
adl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
adl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
adl_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:adl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AURDEDRAFT_111947
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AURDEDRAFT_111947
Enzymes [BR:adl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AURDEDRAFT_111947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 Lycopene_cycl HI0933_like TAL_FSA DAO
Motif
Other DBs
NCBI-ProteinID: EJD50761
JGI: 111947
LinkDB All DBs
AA seq 644 aa AA seqDB search
MLRSRLQRSTPSLLASLRRSFSASAAARKVVATEPVKAQEAKTWGTAGKYPLIEHEYDAI
VVGAGGAGLRAAFGLAEAGFKTACITKLFPTRSHTVAAQGGVNAALGNMTEDDWRWHMYD
TVKGSDWLGDQDAIHYMCREAPKTVIELEHFGVPFSRTKEGKIYQRAFGGQSLKYGKGGQ
AYRCAAVADRTGHSILHTLYGQSLRHNTNFFIEYFALDLIMHEGECVGVLALSTEDGTLH
RFRAHKTVLATGGYGRAYFSCTSAHTCTGDGNAMVTRAGLPLQDLEFVQFHPTGIYGAGC
LITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTLEIRDGRGVGPDKDHIY
LQLSHLPAEVLHERLPGISETASIFCGVDVTKEPIPVLPTVHYNMGGIPTKYTGEVLTVD
KNGNDKIVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACAHHIRDNLEPGKPHKQI
PADAGFHSIEDLDRLRNANGSEPTAKIRLAMQKAMQTDAAVFRTQESLDEGVTKVSEIYK
TYENVGVKDRSMIWNSDLVETLELRNLLQCAVQTITAAAARKESRGAHAREDFSERDDQN
WMKHTLTFQHDMKSPEVEIKYRGVVGTTLDETECKAVPPFKRVY
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgttacgcagcaggctgcagcgctcaacgccctcgctgctggcctcattgcgccgctcg
ttcagcgcgtcggccgcagctcgcaaggtcgttgccaccgagcccgtcaaggctcaggag
gccaagacttggggaacggccggcaagtacccgctcatcgagcacgagtacgacgccatt
gtcgtcggtgctggcggcgccggcttgcgcgccgcgttcggtctggcagaagcagggttc
aagactgcatgcatcaccaagctgtttcccacgcgctcgcatacagtggcagcgcagggc
ggtgtgaatgctgctttggggaacatgaccgaggacgactggagatggcacatgtacgac
acggtcaagggctcggactggctgggcgaccaggacgccatccactatatgtgcagagag
gcacccaagactgtcattgagctcgaacacttcggcgtgccgttctcccgaacaaaggag
ggcaagatctaccagcgtgctttcggcggacagtccctaaagtacggcaagggcggccag
gcgtatcgctgcgccgccgttgccgaccgtaccggccactccatcctgcacacactctac
ggccagtcgctccgacacaacacgaacttcttcatcgaatacttcgcgctcgacctcatc
atgcatgagggagagtgtgtcggtgtcctggccctgagcacggaggatggcaccctgcac
cgtttccgcgcacacaagaccgttcttgcgacgggcgggtacggccgcgcgtacttctcc
tgcacgagtgcacacacctgcacgggcgacggcaacgccatggtcacgcgcgcgggtctt
ccgttgcaagatctcgagttcgtgcagttccacccgacgggcatctacggcgctggctgc
ctcatcaccgagggctcgcgtggcgagggcggctacctgctgaactcggagggcgagcgc
ttcatggagcgctacgcgcctacggccaaggaccttgcgtcgcgtgacgttgtatcgcgc
agcatgacgctcgagatccgcgacgggcgcggtgtcggtcccgacaaggaccacatctac
ctccagctgagccatctgcccgccgaggtcctgcacgagcgtctgcccggtatctccgag
accgcgtccattttctgcggcgtcgacgtcacgaaggagcccatcccggttctgccgacc
gtgcattacaacatgggcggcatccccaccaagtacaccggcgaggtcctcacggtcgac
aagaacggcaacgacaagatcgtgcccggcttgtacgcggctggcgaggcggcctgcgtc
tctgtccacggcgcaaaccgtctgggtgccaactctttgctcgacatcgtagtcttcggc
cgcgcttgcgcgcaccatatcagggataaccttgagcctggcaagcctcacaagcagatc
ccggccgacgctggcttccactccatcgaggacctcgacagacttcggaatgccaatggt
tcggagcccaccgccaaaatccgactggccatgcagaaggccatgcagacggatgctgct
gtcttccgtacgcaggagagcttggacgagggcgtcaccaaggtcagcgagatctacaag
acatacgagaacgtcggcgtcaaggaccgtagcatgatctggaactccgacctcgtcgag
acgcttgagctccgtaacctgctgcaatgcgccgtccagaccatcaccgccgctgctgcg
cgcaaggagagccgtggcgcgcacgcgcgtgaggacttcagcgagcgcgacgaccaaaac
tggatgaagcacacgctcacgttccagcacgacatgaagagcccggaggtggaaatcaaa
taccgcggtgtggtgggcacgacgctggacgaaaccgagtgcaaggctgtgccgccgttc
aagcgtgtgtactag

DBGET integrated database retrieval system