KEGG   Auricularia subglabra: AURDEDRAFT_112485Help
Entry
AURDEDRAFT_112485 CDS       T03129                                 

Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
adl  Auricularia subglabra
Pathway
adl00500  Starch and sucrose metabolism
adl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AURDEDRAFT_112485
Enzymes [BR:adl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AURDEDRAFT_112485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-ProteinID: EJD49662
JGI: 112485
LinkDB All DBs
AA seq 590 aa AA seqDB search
MRLPSVAFFAAAASAFVAQDARFSSGFGLTLGKRAAVDDYVASEGPIALKGVLDNIGPDG
PKSHGAKPGIVVASPSKVDPDYVFAWIRDSALVFKALIDRFVDGRDASRLPLLLQFVSSQ
SAIQNLDNRSGAARGAGLGEPKFEINQTAFNGDWGRPQRDGPALRATALITLSNYFLSKN
NASFVTSTLWPMIQLDLNYVATYWNQPTFDLWEEVNGQSFFTTAVQHRALREGIALAQTL
GTTGSVATWSTQASNVLCYLQSYWTPSGAFINSNTNSGRSGIDVNSILTSIHTFSPNTGC
DAVTFQPCSDKALAGHLAVVNSFRGSLYPINSGIPAGQAVAIGRYKEDVYYNGNPWYLAT
FAAAEQLYLALFTWDQQKSIAVTAISQPFFAQFIPNIATGTYASSSSQYATLTSKIREFA
DGFIAVNQKYTPANGALAEQFTRANGTPISASDLTWSYASALTAFDRRAGIVPGAWPATG
LTVAPSCSTAGGGNSTITFKVTAQTVFGENIYLTGSVAALKNWSPENALGPLANPNYPQW
QITVTVPASTAIEYKYIRKNGGSVVWESDPNRSIVSPAAGESATVTDTWR
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcttccgtctgtcgcattcttcgctgccgccgcgagcgccttcgtcgcgcaggat
gcccgcttcagcagtggcttcggcctcaccctcggcaagcgcgccgccgtcgacgactat
gtcgcgagcgagggcccgatcgcgctcaagggcgtgctcgacaacatcggcccggatggc
cccaagtcgcacggcgcgaagccgggcatcgtcgtcgcgagcccgtcgaaggtcgacccg
gattacgtcttcgcatggatccgcgacagcgctcttgtcttcaaggcgctcattgaccgc
ttcgtcgacggacgcgacgcgtcgcggctcccgctccttcttcagttcgtttcgtcccag
tctgcaatccaaaatctcgacaaccgctccggcgccgctcgcggtgccggcctcggcgag
cccaagttcgagatcaaccagaccgccttcaatggcgattggggcagaccccagcgcgat
ggcccggccctccgtgcgacagcgcttattaccctttcgaactatttcctgtcgaagaac
aacgcctcattcgttacgtccacgctctggccgatgatccagctcgacctcaactacgtc
gcaacgtactggaaccagccgacgttcgatctgtgggaggaggtcaacggccagagcttc
ttcaccaccgccgtgcagcaccgcgcgctgcgcgagggcatcgcgctcgcgcaaacgctt
ggcaccacgggcagcgtcgccacgtggagcacgcaggcgtccaacgtcctgtgctattta
cagtcgtactggacgccttcaggagccttcatcaactctaacaccaactcggggcggtca
gggatcgatgtcaactcgatcctcacgtccatccacaccttctcgcccaacaccggctgc
gacgccgtcaccttccagccgtgctccgacaaggcgctagcaggccacctcgccgtcgtc
aactcgttccgcggcagcctgtaccccatcaactctggcatccccgcaggccaggctgtt
gcgatcggccggtacaaggaggacgtctactacaacggcaacccctggtatctggcgacg
ttcgccgcggcggagcagctgtacctggcgctcttcacctgggaccagcagaagagcatc
gcggtgacggcgatctcgcagcccttcttcgcgcagttcatccccaacatcgcgacgggc
acgtacgcgtcgagcagctcgcagtatgcgacgctcacgagcaaaatccgcgagttcgcg
gacggcttcatcgcggtgaaccagaagtacacgccggcgaacggcgcgctcgccgagcag
ttcacgcgcgcgaacggcaccccgatcagcgcgtccgacctcacgtggagctacgcgtcg
gcgctcaccgcgttcgaccgccgcgcgggcatcgtccccggcgcgtggcccgcgaccggc
ctcaccgttgcgccgtcgtgctcgacggccggcggcggcaacagcaccatcaccttcaag
gtgaccgctcaaacagtgtttggcgagaacatatacctcaccggcagcgtggcggcgctc
aagaactggtcgccggagaacgcgctgggcccgctcgcgaaccccaactacccgcagtgg
cagatcacggtgacggtgccggcgagcacggcgatcgagtacaagtacatccgcaagaac
ggcggctcggtcgtgtgggagagcgacccgaatcgcagcatcgtgtcgccggcggcgggc
gagagcgcgacggtgacggacacgtggcggtag

DBGET integrated database retrieval system