KEGG   Auricularia subglabra: AURDEDRAFT_117124Help
Entry
AURDEDRAFT_117124 CDS       T03129                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
adl  Auricularia subglabra
Pathway
adl00250  Alanine, aspartate and glutamate metabolism
adl00410  beta-Alanine metabolism
adl00430  Taurine and hypotaurine metabolism
adl00650  Butanoate metabolism
adl01100  Metabolic pathways
adl01110  Biosynthesis of secondary metabolites
Module
adl_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:adl00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AURDEDRAFT_117124
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AURDEDRAFT_117124
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AURDEDRAFT_117124
   00430 Taurine and hypotaurine metabolism
    AURDEDRAFT_117124
Enzymes [BR:adl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AURDEDRAFT_117124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: EJD36278
JGI: 117124
UniProt: J0CYB0
LinkDB All DBs
AA seq 529 aa AA seqDB search
MLSLHIDPEEVLQKAADNPVKKQDSRSAFHSYVRDGDIPIPKYTLPETGVNSKVAYQVIH
DELTLDGNPTLNLASFVHTWMPPEAEKLIMENISKNAVDQDEYPATQVIHARCISMLANL
WKVPKGMKAIGTATAGSSEAIMLGGLALKKRWQEKRKAEGKDYFHPNIVFGANAQVALEK
FARYFDVECRLVPVKEEHDFIMHPPDALQYIDENTIGVMVILGSTYTGHFEDVALMSDLL
DKLYEEKGLDIPIHVDGASGGFFAPFAYPELKWSFDIPRVASINTSGHKFGLVYAGLGWV
LWKDESLLPKDLIFELHYLGSVEYSFTLNFSKPAAPIIAQMFNFLNLGYQGYRDVARKDL
RNARLLSRALETTGYYKVLSNIHKESGNKNAGEHEPELYLPGLPVVAFRLSDEFKNDYPH
VQQAWIQNLLRGKGWIVPNYGAPPAEDKQEILRVVVRETMTADLVERLVTDLIAITESLM
TTDSSGGTAQMMAAIAGPHSKQGVHQPEAEHGRPQRPHPKRQNTYAKQC
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgctgcacattgaccccgaagaagtcctccaaaaagccgccgacaaccccgtc
aagaagcaagacagccgcagcgcgttccacagctacgtgcgcgacggcgacatcccaatt
cccaaatacacgctgcccgaaaccggcgtcaactcgaaagtcgcgtatcaggtcatccac
gatgagctcacgctcgacggcaacccgacgctcaacctggccagcttcgtgcacacctgg
atgccgccggaggccgagaagctgatcatggagaacattagcaagaacgcggtcgaccag
gatgagtatccggccacccaagttatccacgcgcgctgtatctccatgctcgcaaacctg
tggaaagtgcccaagggcatgaaggccatcggcacggcgacggctggctcgagcgaggcc
atcatgctcggtggcctcgcgctcaagaagcgctggcaggaaaagcgcaaggcggagggc
aaggactacttccaccccaacatcgtcttcggcgccaatgcgcaggtggccctggagaag
ttcgcgcgctatttcgatgtcgagtgccgtctggtgccggtcaaggaggagcacgacttc
atcatgcacccgccggatgcgctgcagtacatcgatgagaacaccatcggcgtcatggtt
attctcggcagtacctacaccggccacttcgaggatgtggcgctgatgagtgacttactg
gacaagctttatgaggagaagggactcgacatcccaatccacgtcgacggcgcctccggc
ggtttctttgcgcccttcgcgtaccctgagcttaaatggagcttcgacataccgcgcgtt
gcgagcatcaacacttccggccacaagttcggtctcgtctacgcgggcctaggctgggta
ctctggaaagatgagagcctgctgcccaaggacctcatcttcgagctgcactacctcggc
tctgtagaatatagcttcacgctcaacttctcgaagcccgctgcacccatcatcgcgcag
atgttcaacttcctcaacctcggctaccagggctaccgcgacgttgcgcgcaaagatctg
cgcaacgcacgcttgctgagcagggcgctcgagacgactggctactacaaggtgctgagc
aacatccataaggagtcgggcaacaagaacgccggcgagcacgagcccgagctgtacctt
cccggcctgccggtcgtcgcgttccgcctttcggatgagttcaagaacgactatccacat
gtccagcaagcttggatccagaacctgctgcgcggcaaaggctggattgtgcccaactat
ggcgcgccgcccgccgaggacaagcaggagatcctgcgcgtcgtcgtgcgcgagacgatg
acggccgatctcgtcgagcggctcgtgaccgacctcatcgcgatcacggagagcctaatg
acgaccgactcgtccggcggcaccgcgcagatgatggccgccatcgcgggcccgcactcg
aagcagggcgtgcatcagcccgaggcggagcatggccgcccgcagaggccgcaccccaag
aggcagaacacgtacgccaagcagtgctaa

DBGET integrated database retrieval system