KEGG   Auricularia subglabra: AURDEDRAFT_133809Help
Entry
AURDEDRAFT_133809 CDS       T03129                                 

Definition
(GenBank) glycosyltransferase family 15 protein
  KO
K10967  alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
adl  Auricularia subglabra
Pathway
adl00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:adl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    AURDEDRAFT_133809
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:adl01003]
    AURDEDRAFT_133809
Enzymes [BR:adl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     AURDEDRAFT_133809
Glycosyltransferases [BR:adl01003]
 Glycan extension
  Yeast mannan chain
   AURDEDRAFT_133809
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_15 RecA_dep_nuc
Motif
Other DBs
NCBI-ProteinID: EJD52968
JGI: 133809
LinkDB All DBs
AA seq 401 aa AA seqDB search
MHARTRYFLVFVVSLVGCARCTLHDAQPNPQLVIHLILSRTHRGYNDAAASQKQRFASAL
YKPSASKIPPGSAGLSDTQQIVNQEERAAFLNRKANASIVMLAREIDLEGVISTMKQVED
RFNRKFNYPWVFLNDKPFSDRFMNWTSRMTDSPVEYGVIPRDHWNQPPWINETRAAETRE
RMKKENVLYGCTYRNMCRYNSGFFFRHPLLQKYRYYWRVEPGVKFYCDLHFDPFLFMQDH
NKVYGFTVALFEYEGTVTTLWESVRRFMKKYPQYIHKNNALRFISNDRGKTYNLCHFWSN
FEIADMDFWRSEAYMKFFSHIDRNGGIYYERWGDAPIHSIAVALLADKNQLHFFDEIGYR
HEPFEHCPSGEAHARGKCWCNTDETFDTMWYSCMQEFQRVY
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcacgctaggacgcgctactttctcgtcttcgtggtatccctcgtaggttgcgcccgc
tgtacgctacacgacgctcaacccaacccgcagttggtcatacatttaatcctttcgcgc
acccaccgaggatacaacgatgccgctgctagtcagaaacaacgcttcgcgagcgcactg
tacaagccgtccgcgtccaagatacccccaggcagcgccggactctcagatacccagcag
atagtcaaccaagaggaacgcgctgcgttcctcaaccgcaaggcgaacgcgtcgatcgtc
atgctcgcgcgggagatcgacctggaaggtgtcatctcgaccatgaagcaggtcgaggat
cgcttcaaccgcaagttcaactacccttgggtcttcctgaacgacaaacccttctcggac
cgtttcatgaactggacgtcgcgcatgacagattcgcccgtcgagtacggcgtcattccc
cgggaccactggaaccagccgccctggataaacgagacgcgcgcggcagagacacgtgaa
cgcatgaagaaagagaatgttctatacggttgtacgtatcgcaacatgtgtcgctataac
tcaggattcttcttccgacatcctctcctgcaaaagtaccgctactattggcgcgtagag
ccaggagtcaaattctattgtgatctgcatttcgacccgttcctgttcatgcaagaccat
aacaaagtgtatggcttcaccgtcgcactgttcgaatatgaagggacagtgacgacgctg
tgggagtcagtgcgccgcttcatgaagaagtacccgcaatacatccacaagaacaacgcg
ctgcgcttcatctcgaacgaccgcgggaagacgtacaacctctgtcacttttggagtaac
tttgaaatcgccgacatggatttctggcggagcgaggcgtatatgaagttcttctcgcac
atcgacagaaacggcgggatatactatgagcgctggggtgacgcaccaatacacagtatt
gcagtcgcattgttggccgacaagaaccaactccatttcttcgacgagatcgggtaccgt
cacgagccattcgagcactgcccgagcggcgaggcccacgcgcgtggcaaatgctggtgt
aacacggatgagaccttcgatacaatgtggtactcatgcatgcaggaattccagcgtgtt
tactaa

DBGET integrated database retrieval system