KEGG   Auricularia subglabra: AURDEDRAFT_143420Help
Entry
AURDEDRAFT_143420 CDS       T03129                                 

Definition
(GenBank) Arginase/deacetylase
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
adl  Auricularia subglabra
Brite
Enzymes [BR:adl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     AURDEDRAFT_143420
Chromosome and associated proteins [BR:adl03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     AURDEDRAFT_143420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl BOFC_N
Motif
Other DBs
NCBI-ProteinID: EJD50534
JGI: 143420
LinkDB All DBs
AA seq 626 aa AA seqDB search
MPAIFLQEVCLKHRYIRSRDTSGIVERPERLRAINVGLATAVARIENARSNTVLPGPVVP
NAADALADALSKLGIAEGASKPSAATTNAPDPTKLSDDPLTAALNKLSISSTGPSGALRD
DDEANNPVVTFIRSKAAVDICTHPAVDYIHGDEDPAANPLLKLREWTNACEERLKAKESE
VPAHLPQGDLYLCPQSIEAISGAVGTVCEAVDHVIERSKVVGPSETSADRRAFVAIRPPG
HHCDEANPSGFCWVNNVAIAAAHAHLQHGITHVIVLDVDLHHGNGTQTIAWRINEDAYRQ
ELEAEAVAEAGQPPKPTPLRFYYGSVHDILSYPCEDGKASLVAAASVKIAGAHGQHIENI
HLETYTSMDEFWKLYEGPYSRLLGQAENFCKVTDAKPENTLVFISCGFDANELEYASMSR
HGRYVPPAFYARFTRDAAAFAARCAGGKLVSVLEGGYSDRALASGALAHVAGLVSPTPFP
GEDEWWSLESLVKTDGQMEKATAKKARKASQGKTEPWVERAAAIFGAIDVKPPAPPASAA
SQVPTPTRVLRERPPRSAAASPPVSKGKAQQKAPVLARPPAHDDSDSPLTDLSDSEPDQA
TRAPPAQAVEKKLPRVILHVKPPPTS
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcaatattcctgcaagaggtctgtctgaagcaccggtatatccgatcgcgggac
acgtctggcattgtggagcgtcctgagcgcctgcgcgctatcaacgtcggactagccacc
gctgtcgcacgcatagagaacgcacgcagcaataccgtcttacctggcccggtggtacca
aacgccgcagatgccctagcggacgcgctgtcaaaactgggcatcgctgagggcgcatcc
aagcccagcgccgccaccacgaacgccccggatcccaccaagctctccgacgaccctctg
actgccgccctcaacaagctcagcatttcttctacggggccctcgggcgctcttcgcgat
gacgacgaggcgaataaccccgtggtgacattcatcaggagcaaagcggccgtggatatc
tgcacgcaccctgcagtagattacatccacggtgacgaggaccccgctgcaaaccccctg
ctgaagctgcgagaatggacgaacgcgtgtgaagagcgtctgaaggcgaaagagagtgag
gtgcccgcgcatcttccccagggcgatttatacttgtgtcctcaatccattgaggccatt
tctggcgcggtcgggaccgtgtgcgaggcggtagaccatgtaatcgagaggtcgaaggtc
gtcggcccaagcgagacttcagctgaccgccgcgccttcgttgcgataaggccgcccgga
catcactgcgacgaggcgaatccttctgggttctgctgggtcaacaacgtcgcaatagcg
gcagcccacgcgcacctccaacatggtattacccatgtgatcgtcctggacgtcgacctt
catcatgggaacggtactcaaaccatcgcctggaggataaacgaggacgcgtaccgccag
gagctcgaggcagaggccgtggccgaagctggtcaacctcctaagcctacgcctcttcgt
ttctactacggttctgtccacgatattctctcatatccttgcgaggacggcaaagcgtcc
cttgtcgctgcggccagtgtcaagatcgccggcgcgcacggacaacacatcgagaacatt
cacctcgagacgtacacctccatggacgagttctggaagctctacgaaggcccttactcg
cgtcttctcgggcaggccgagaacttctgcaaagtgacggacgcgaagcccgagaacacg
ctcgtcttcatcagctgcgggttcgacgcgaacgagctcgagtacgcgtcgatgtcgcgg
cacgggcgctacgtcccgccggcgttctacgcgcgcttcacgcgcgacgcggcagcattc
gccgcgcggtgcgctggcgggaagctcgtgagcgtgctggagggcgggtactcggaccgc
gcgctggcaagcggtgcgctggcgcacgtagccggcctcgtctctcccacccccttcccc
ggcgaggacgagtggtggtctctcgagagcctcgtgaagacggacggacagatggagaag
gcgacggcaaagaaggcgcgcaaggcgagccagggcaagaccgagccgtgggtcgagcgc
gcggctgcgatcttcggcgccatcgacgtcaagccgccggccccgcctgcgtcggcggcg
agccaggtgccgacgccgacacgcgtgctgcgcgagcgcccgccgcgctcggcggccgcc
agcccgccggtgtcgaagggcaaggcgcagcagaaagcccccgtgctcgcgcgcccgccg
gcacacgacgactcggactcgcctctcacggacctcagcgacagcgagcccgatcaggcg
acgcgcgcaccgcccgcccaggctgtggagaaaaagctgccccgcgtcatcctccacgtc
aagcctcctccaacctcatga

DBGET integrated database retrieval system