KEGG   Auricularia subglabra: AURDEDRAFT_156604Help
Entry
AURDEDRAFT_156604 CDS       T03129                                 

Definition
(GenBank) phosphatases II
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
adl  Auricularia subglabra
Pathway
adl00562  Inositol phosphate metabolism
adl01100  Metabolic pathways
adl04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:adl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AURDEDRAFT_156604
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    AURDEDRAFT_156604
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:adl01009]
    AURDEDRAFT_156604
Enzymes [BR:adl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     AURDEDRAFT_156604
    3.1.3.48  protein-tyrosine-phosphatase
     AURDEDRAFT_156604
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     AURDEDRAFT_156604
Protein phosphatases and associated proteins [BR:adl01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    AURDEDRAFT_156604
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc CDKN3 Y_phosphatase3 PTPlike_phytase Y_phosphatase
Motif
Other DBs
NCBI-ProteinID: EJD54825
JGI: 156604
LinkDB All DBs
AA seq 621 aa AA seqDB search
MASYVRRIVSGYKARFKDDSSGVDLDLIYLTDQIIIMGFPAEGIEGYYRNRREDVRKFLD
SRHGGNYWVFNLCPLTENSYPAAVFNGRVSRHPFPDHHAPPLATLALAAREIGEWLRGSE
DRVAVLHCKAGKGRSGTIACAYLLSQESSLSAPKLERSYTSKEWARARANELLEAIEIEE
EELEARENAKNNDKKPLPVVDEDAPLVDEPQPTSAPEPHIVQSGGVQTEVKHSGPGLEEV
LALHTTRRMRRPSSPSDKQKRGVSIPSQRRFLSYWAMILEHAAPAPLWPRNPTAAARPQV
RLREMRVRLREPGGAKMTALKVVNSLLETAGVQQGRKKAGRDVQTDELWVSLARYRDDFV
DTLEGWERHTRDPSGRMGRRRPGAEHMQGGEEGEQRLEQLFEGGKWDKSKMVKIFSHLST
TDVEVVQQVRLAAGGGDLSTSDPTQEKSRLLTYVLHPIPHSQWVHVRKKIKSVTTKVELP
VERSEQDVSLPGSTHTTPDASRNASMENLIEGDGLLLDACREVRAKLYLGQIFLGWFWFI
PIFHVAPGSAGAVHFVLEKREVDFTVGAGAWIIDVDVAMDWVGADAPAAPPATSDTSTEN
LEAVQSAENLGVKTMDAAGNQ
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggccagctacgtgcgccgaatcgtctctggctacaaggccaggttcaaggacgactcc
agcggcgtcgacctggacctgatatacctgactgaccagataatcatcatgggattcccc
gcggagggcatcgaaggctactatcgcaatcggcgcgaggacgtcaggaagttccttgac
tcgcggcacggcggcaactactgggtcttcaacctctgtccgctcacagagaactcgtac
ccagccgctgtcttcaacggtcgcgtatctaggcacccgttcccggaccaccatgcacca
cctctggctacgcttgcccttgctgcccgcgaaattggcgagtggcttcggggttcggaa
gaccgcgttgccgtgctgcattgcaaagccgggaagggacgctctgggaccatcgcatgc
gcctacctactatcgcaagaaagctcgctgtctgccccgaaactcgagcgaagctatacg
agcaaggagtgggcccgcgcccgcgccaacgaactccttgaagccatcgaaatcgaagag
gaagaactcgaggcgcgcgaaaatgcgaagaacaacgacaagaaaccgttacctgtcgtc
gacgaggatgcgcctttggtcgacgagccgcagccaacctccgcccccgagccccacatc
gtacaatcagggggcgtccaaacggaagtgaagcactcagggccgggccttgaggaagtg
cttgctttgcacacaacccgccgcatgcgtaggcccagctcgccctcggacaagcagaag
cgcggcgtctcgatcccgtcgcagcgccgcttcctgtcctactgggcgatgatcctcgag
cacgccgcgcccgccccgctgtggccaaggaaccctacggcggcagcccggccacaggtc
cgcctgcgcgagatgcgcgtgcggctgcgcgagcccggcggggcgaagatgaccgcgctg
aaggtcgtcaattcgctgctcgagactgcaggcgtgcagcagggccggaagaaggcgggg
cgcgacgtccaaacggacgagctctgggtctcgctcgcgcgctaccgcgacgactttgtc
gacacgctcgagggctgggagcggcacacgcgtgacccctccgggcgcatgggacggcgg
cggcctggcgcggagcacatgcagggcggcgaggagggcgagcagcggcttgagcaactg
ttcgagggcggcaagtgggataagagcaagatggtcaagatcttctcgcacctcagcacg
accgacgtcgaggttgtccaacaggtccgtcttgcggctggaggtggcgacctttcaacg
tctgatcccacacaggagaagtcgcgcttgctcacctacgtcctacacccgatcccgcac
agccagtgggtgcacgtccgcaagaagatcaagtcggttacgacgaaggtcgagctgccg
gtggagaggtccgaacaagacgtctccctcccaggctccacccacacgactccagacgcg
tcgcgcaacgcgtccatggagaacctcattgagggtgacgggctgctccttgacgcatgc
cgcgaggtgcgcgcaaaactctaccttggccagatcttcctcggctggttctggttcata
ccgattttccacgtcgcgcctggatcggcgggggcagtgcatttcgtcctcgagaagagg
gaggtcgacttcaccgtcggcgccggcgcgtggatcatcgatgtcgatgtcgcgatggac
tgggtcggggcggatgcacccgccgcgccgcctgcgacgagcgacacgtccacggagaat
ttggaggctgtgcaatcggcggagaacttgggggtgaagactatggatgctgctggcaac
caatag

DBGET integrated database retrieval system