KEGG   Auricularia subglabra: AURDEDRAFT_166092Help
Entry
AURDEDRAFT_166092 CDS       T03129                                 

Definition
(GenBank) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
adl  Auricularia subglabra
Pathway
adl00052  Galactose metabolism
adl00500  Starch and sucrose metabolism
adl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AURDEDRAFT_166092
   00500 Starch and sucrose metabolism
    AURDEDRAFT_166092
Enzymes [BR:adl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     AURDEDRAFT_166092
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-ProteinID: EJD44910
JGI: 166092
LinkDB All DBs
AA seq 974 aa AA seqDB search
MLVLPFLLFFAPGALASARPWSSRSSSVYTHARSQNISYRDDSPLSLNVGSCPGYKLDSV
KQDRFGLTAHLTLAGAACNAFGNDYTDLTIEVTYESSTRSVSIPSPHPFLISVPSLHVLI
TDASDKQFVIPQSVIERPAPPTESFVELVFNYESNPFAFWITRRDEPDGMPLFDTRIASL
PKTPVAPVREDDPSTALDGFPLVFEDQYLQLTSALPLDANVHGLGEVLASSGFRRELGGK
GTVQAFWSRDRADPFDENLYGSHPIYMEHRLSDSGEAKTHGVFLMSAAAADILLLTPPDS
PVSLVQYRLVGGALDFYFMAGPSPVRVIEQYAEIVGLPTWQPYWGFGFHLSRWGYNDIAA
TRDQVNRMREANIPLETIWNDIDLYHNKRDFTTDPANFPGDQLRAFIKELADKHQHYIPI
VDAGIARTTDDSDVYEPWTKGVEQNVFMTNPDGSLYIGEVWPGKTAFPDWFAEKTQGWWT
DAFRKWRADGVEWSGIWLDMNEVSSFCDGSCGSNPSRRAKRAVKPRMIDGWTRVNASAYV
IATPGKRDECDAEGDGDMDSDEDGGNAGANRPPIEHHGVGAGFGPLGSHGVLPEARHAGG
YAELDVHNMWGLMEERATHNALRDIQQGQRPFIISRSTFPSSGRWTGHWLGDNLSGWEWL
YASIQGVLQFQLFQIPMVGADACGFIGDTNEELCNRWMQLAAFTPFYRNHNVAGTISQEP
YVWESVAEASRKAMAVRYKMLPYWYTLFADSSRRGTPPMRALWYEFPTEKELFGVDRQFL
IGPNILVSPVVDKETTSVDAFFPGVETGTVWRDWYTHAAVGAKAHEKTALDAPLGHINVH
IRSGSAILLHGLLGYTTAETREGPYELLVSLDRDGTASGTAYIDDGISYPPGPSADVSFA
MSNGTLIVSKQGDWHVERTLDRIKILGLNSAPRKLSFNGQLWDPASYTFDESIGRLDVPQ
IAFNINNGVVMVLE
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atgcttgttcttccttttctcctcttcttcgctcctggcgcgctcgcctctgcgcgccct
tggtcttctcgctcttcttcggtttacactcatgctcgctctcaaaacataagttatcga
gacgactcgcccctctcgctgaatgttggctcatgccccggctacaagctcgattccgtc
aagcaggaccgcttcggcctcactgcgcacctcacgctcgccggcgccgcctgtaatgcg
ttcgggaacgattatacagacttgacgatcgaagtgacctatgagtcttctacccggtcc
gtctccatcccctcgccccaccccttcctcatctccgttcccagcctacacgtcctcatc
accgacgcctccgacaagcaatttgtcatcccgcagtccgtcatcgagcgccccgcgccg
ccgaccgagtctttcgtcgagctcgtatttaactacgaatccaacccattcgcgttctgg
atcacacgccgcgatgagccggacggcatgccgctcttcgacacgcgtattgcgtctctg
ccaaagacgccggtcgcgcccgttagggaggacgacccgagcacggcgctcgatgggttt
ccgctggtattcgaggatcagtacctccagctgacgtctgcactcccgctcgacgcgaac
gtccacggcctcggcgaggtgctcgcgagcagcggcttccggcgcgaactcggcggcaag
ggcaccgtgcaggcgttctggtcgcgcgaccgcgccgacccgttcgatgagaacttgtac
ggctcgcaccccatctacatggaacaccgtctctcggactccggagaggcgaagacgcac
ggcgtgttcctcatgagcgcggccgcagcagacatactgctcctcacaccgcccgactcc
ccggtctcgctcgtgcagtaccgcctcgtgggcggtgcgctcgacttctacttcatggcg
ggcccgtcgcccgtccgggtcatcgagcagtacgccgaaatcgtcgggcttccgacgtgg
cagccgtactggggcttcgggttccacctgtcgaggtgggggtacaacgatatcgccgcg
acgcgcgaccaggtgaatcgcatgcgcgaggcgaatatcccgctcgaaactatctggaac
gatatcgacttgtatcacaacaagcgcgacttcacgaccgacccggccaacttccccggc
gaccagctgcgcgctttcatcaaagagcttgccgacaagcaccagcactatatccccatc
gtcgacgccggtattgcgcggacaacagacgacagcgacgtttacgagccctggacgaag
ggcgttgagcagaatgtcttcatgacgaaccccgacggctcgctgtacatcggcgaagtc
tggcccggcaagaccgcgttcccggactggtttgcagagaagacgcagggctggtggacg
gacgcgttccgtaagtggcgtgcggacggcgtcgagtggagcggcatctggctcgacatg
aacgaggtcagctcgttctgcgacggctcgtgtgggtcgaacccgagcaggcgagcgaag
cgcgctgtcaagccgcgcatgatcgacggctggacgcgcgtcaacgcgtcggcctatgtc
atcgcaacgccggggaagcgggacgagtgcgatgctgagggcgacggcgatatggattcc
gacgaagacggcggcaatgctggtgcaaaccgcccgcccattgagcaccacggcgtcggc
gcgggcttcggtcccctcggcagccacggtgtgcttcccgaggcacggcacgcgggcgga
tacgccgagctcgacgtgcacaacatgtggggcctgatggaggaacgcgcgacgcacaac
gccctgcgcgacatccagcagggccagcggccgttcatcatctcgcgctcgacgttcccc
tcgtccggccgctggacgggccattggctcggagataacctgagcggctgggagtggcta
tacgccagcatccagggtgtcctgcagttccaactcttccagattcccatggtcggtgct
gacgcatgcggatttatcggagacaccaacgaggagctctgcaatcgctggatgcagctc
gcggctttcacgccgttctacaggaaccataacgtcgcgggaacgatctctcaggagccg
tacgtatgggagagcgtcgcggaggcctccagaaaagcgatggccgttcgctacaagatg
ctgccgtactggtacactctgtttgccgactcctcgcgccgcgggacgccaccgatgcgt
gcgctatggtacgagttcccgaccgagaaggagctcttcggcgtcgacaggcagttcctc
atcggccccaacatcctcgtctctcccgtcgtcgacaaggagacaacttctgttgatgca
ttcttccctggggtagagacggggacggtctggcgcgactggtacactcacgctgcggtg
ggcgccaaggcgcatgagaagacggcgctcgacgcgccgctggggcacatcaacgtgcac
atccgttcgggctccgcgatcctccttcacgggcttctcggttacacgacagctgagacg
cgcgagggtccgtacgagcttctggtctcgctcgaccgggacggcaccgcgtccggcacc
gcgtacatcgacgatggcatttcatacccgccagggccgagcgcggacgtctcgttcgcg
atgtcgaatgggactctcatcgtctcgaagcagggtgattggcatgttgaacggacgctc
gacaggatcaagatcctcggcctgaacagtgcgccacggaagttgtcgttcaatggccag
ttgtgggatcccgcgtcgtacacgttcgacgagtccatcggtcgcttggatgtgccccag
attgcgttcaatatcaacaatggagtcgtgatggtgcttgagtga

DBGET integrated database retrieval system