KEGG   Auricularia subglabra: AURDEDRAFT_182254Help
Entry
AURDEDRAFT_182254 CDS       T03129                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex E1 component mitochondrial precursor
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
adl  Auricularia subglabra
Pathway
adl00020  Citrate cycle (TCA cycle)
adl00310  Lysine degradation
adl00380  Tryptophan metabolism
adl01100  Metabolic pathways
adl01110  Biosynthesis of secondary metabolites
adl01130  Biosynthesis of antibiotics
adl01200  Carbon metabolism
Module
adl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
adl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:adl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AURDEDRAFT_182254
  09105 Amino acid metabolism
   00310 Lysine degradation
    AURDEDRAFT_182254
   00380 Tryptophan metabolism
    AURDEDRAFT_182254
Enzymes [BR:adl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AURDEDRAFT_182254
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: EJD50927
JGI: 182254
LinkDB All DBs
AA seq 1012 aa AA seqDB search
MLRRLATETRRAPRIARAVYRRPTVLLGARHLATPAAAQPPSPNDPFATGTNTYYVEEMY
RHWKDDPKSVHVSWDAYFSGLDKGVRPQDAFQPPPTIQHLPTPAGGAPTLHSLSGNSNDL
SDHLKVQLLVRAYQVRGHHVAELDPLGIQGADLNDQRPVELELSHYGWNERDLDKEFTLG
PGILPHFATDGRTSMTLRDIIGTCKRIYCGAIGIQYIHIPDKEQCDWIRERVEVPKPWNY
TVEEKRMILDRLIWSESFEKFIASKYPNEKRFGLEGCESLIPGMKALIDRSVEHGVKDIT
MGMPHRGRLNVLANVIRKPIEAILNEFKGSQADDGGGDVKYHLGANYVRPTPSGKRVALS
LVANPSHLEAEDPVVLGKTRAIQHQNNDEQAHTTAMGLLLHGDAAFAGQGVVYETMGFHS
LPYYGTGGTVHLIVNNQIGFTTDPRFARSTPYPSDLAKAIDAPIFHVNGDNVEAVTFVCQ
LAADWRAKYKKDVVIDIVCYRRYGHNETDQPHFTQPRMYQAIEKQPTPLTQYTKFLIDRG
TFTEKDIEEHKKWVWGMLEKAAAAAADYVPSSKEWLSASWQGFPSPKELAENTLPQNNTG
AEEETLKRIGKAISSYPQGFNVHRNLARILTARGKTIEEGANIDWATAEALAFGSLALEK
VHVRVSGQDVERGTFSQRHAVLHDQVTEAQYVPLNDLGGDQARFVVCNSSLSEFGCLGFE
LGYSLVSPKSLTMWEAQFGDFVNNAQCIIDQFIASGERKWLQRTGLVMSLPHGYDGQGPE
HSSGRIERFLQLMDDHPHHFPSPEKMERQHQDCNMQITYPTTPANYFHVLRRQIHRDFRK
PLINFFSKSLLRHPLARSSLEEMTGDTHFIRYIPEPHPESLAAPEEIKRHILCSGQVYYT
LLKEREDRGLNDIAISRLEQIAPFPYDLLTAHLDKYPNAELIWCQEEPLNCGAWTYVGTR
ILTAANRTEHHQGKYPHYAGRAPTSSVATGSKKAHKLEIEQFLERALGPNPL
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtaggctggccacagagacacggcgggctccgcgcatcgctcgcgcggtatac
cgccgcccgaccgttttgctcggcgcgcgtcatttggcgactccagcggctgcccaaccg
ccgtctcctaatgacccgtttgcgactgggaccaacacctactatgtcgaggagatgtat
aggcattggaaagacgaccccaagtccgtccacgtatcctgggacgcgtatttttctggc
ctcgacaagggggtcagaccgcaggacgcgttccaacctcccccaaccatccagcacctg
cctacgccggccggaggcgctcccacgctgcattcgctgagcggaaacagcaatgaccta
tcggaccaccttaaggtgcaattactcgttcgcgcctaccaggttcgcggccatcatgtt
gcagagcttgatccactcggaattcagggcgcggacctgaatgatcagcgacctgtcgaa
ctcgagctcagccactacggttggaacgagcgtgacctcgacaaggaattcacgctcggg
cccggcattctgccccactttgcgacggacggacggacgtccatgactctccgggacatc
attgggacctgcaagcggatatattgcggcgcaatcggtatccagtacatccacatcccc
gacaaggagcagtgcgactggatccgcgagcgcgtcgaggtgcccaagccatggaactac
acggtcgaggagaagcgcatgatcctcgaccgcctcatctggtccgagtcgttcgagaag
ttcatcgcgtccaagtacccgaacgagaagcggttcgggctcgagggctgcgagtcgctc
atccccggcatgaaggcgctcatcgaccgctccgtcgagcacggcgtcaaggacatcacc
atgggcatgccgcaccgcggtcggctcaacgtgctcgccaacgtgatccgcaagccgatc
gaggccatcctgaacgagttcaagggctcgcaggccgacgacggcggcggcgacgtcaag
taccacctcggcgcgaattacgtgcggccgacgcccagcggcaagcgcgtcgcgctgtcg
ctcgtcgcgaatccgtcccatctggaggcggaggaccctgtcgtgctcggcaagacgcgc
gcgatccagcaccagaacaacgacgagcaggcgcacacgaccgcgatgggcctgctgctg
cacggcgacgcggcgttcgccgggcagggcgtcgtgtacgagacgatgggcttccactcg
ctgccgtactacggcaccggcggcaccgtccacctcatcgtcaacaaccagatcgggttc
acgacggacccgcggttcgcgcgctcgacgccgtacccgagcgacctcgcgaaggccatc
gacgcgcccatcttccacgtcaacggcgacaacgtcgaggcggtcacctttgtgtgtcag
ctcgcggccgactggcgcgccaagtacaagaaggacgtcgtgatcgacatcgtgtgctac
cgccgctacggccacaacgagacggaccagccgcacttcacacagccgcgcatgtaccag
gcgatcgagaagcagccgacgccgctcacgcagtacaccaagttcctcatcgaccgcggc
acgttcaccgagaaggacatcgaggagcacaagaagtgggtgtggggcatgctcgagaag
gccgccgcggccgccgcggactacgtgccgagcagcaaggagtggctctccgcgtcctgg
cagggcttcccctcgcccaaggagctcgcggagaatacgctgccgcagaacaacaccggc
gcggaggaggagacgctgaagagaatcggcaaggcgatctcgagctacccgcagggcttc
aacgtgcaccgcaacctcgcgcgcatcctgaccgcgcgcggcaagacgatcgaggagggc
gcgaacatcgactgggcgacggccgaggcgctcgcgttcggcagcctcgcgctcgagaag
gtgcacgtgcgcgtgtcgggccaggacgtcgagcgcggcacgttctcgcagcggcacgcg
gtgctgcacgaccaggtcaccgaggcgcagtacgtgccgctcaacgacctcggcggcgac
caggcgcgcttcgtcgtgtgcaactcgtcgctgtccgaatttgggtgcctcggcttcgag
ctcggctactcgctcgtctcgcccaagagcctcaccatgtgggaggcgcagttcggcgac
ttcgtcaacaacgcgcagtgcatcatcgaccagttcatcgcctcgggcgagcgcaagtgg
ctccagcgcaccggcctcgtcatgagcctcccgcacggctacgacggacagggccccgag
cactccagcggccgcatcgagcgcttcctgcagctcatggacgaccacccgcaccacttc
ccgtctccggagaagatggagcgccagcaccaggactgcaacatgcagatcacgtacccg
accaccccggccaactacttccacgtcctccgtcgtcaaatccaccgcgacttccgcaag
ccgctcattaacttcttctccaagtctctgctccgtcacccgctcgcgcgctcgtcgctc
gaggagatgaccggcgacacgcacttcatccgctacatccccgagccgcaccccgagtcg
ctcgccgcgcccgaggagatcaagcgccacatcctgtgctcgggccaggtctactacacg
ctgctcaaggagcgcgaggaccgcgggctgaatgacattgcgatctcgcgcctcgagcag
attgcgccgttcccgtacgacctgctcacggcgcacctggacaagtacccgaacgcggag
ctcatctggtgccaggaggagccgctcaactgcggcgcgtggacgtacgtcggcacgcgc
atcctgaccgcggcgaatcgcacggagcaccaccagggcaagtacccgcactacgccggg
cgcgcgcccacgagctcggttgcgacgggcagcaagaaggcgcacaagctcgagatcgag
cagttcctcgagcgcgcgctcggcccgaacccgctgtaa

DBGET integrated database retrieval system