KEGG   Auricularia subglabra: AURDEDRAFT_183615Help
Entry
AURDEDRAFT_183615 CDS       T03129                                 

Definition
(GenBank) kinase-like protein
Organism
adl  Auricularia subglabra
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RIO1 Kinase-like APH Kdo
Motif
Other DBs
NCBI-ProteinID: EJD48303
JGI: 183615
LinkDB All DBs
AA seq 1260 aa AA seqDB search
MAELLTVAGVAITVPAILQAAWTALKAAYDLYGNVDTRRRQIGVLLNRCRDLVAKIAQHL
ASVTGAEISTYVRAGVDELQRACEEIKAVLELLKQKGFLWCMLHQDKIDIQLSDAEHKIA
DAFQMLHFVAHLQGDIMQQELRQAQTQDRDEFVALLDNLSVNDERILKAVQDQDGIHRRL
EDLLVAVLKHVETLDTQNTSPEAKFLRSASVVLGRRSSGRPEDVSADWVVSSLDVEFDKA
ASIGEGSFGRVFKAQWTGIRVAVKQMYNEDARTLSRRDRKAMYQEVKLWATLHHPNILEL
YGACLEATLPFLVMRYCSLGDLRSFLPDHPDVNRVDICYDIVAGMNYLHGRGVVHADLKC
ANIMVDDRHVALVADFGLSHTIQAIRTNSVSTRRDSARGTLRWMAPELLNGSPITKASDV
YSLGVTMWEVFSEQIPFASVSDLVLSRLVVDQGQRPLCPARLQSHDVLWRLVQKCWAHEP
ASRPSMGEVQRTMQPLTTRLGTTDAYIPGDTPLPDRAGGTGLPLSARPREQKVADSTVDI
SASIVDMNADDLPRPLPAGVYAMHLTATYGLATDNAHYPVLKMGEFTFWAFSYDDNRDSY
AIVMYDGSRAFVQVIELPGARWVHSIALSEDGKATFTGQDNHAATITLATFVDTRRHQIG
VLLDRCRDLVTKIDHHLSTQHGAEVSLSVHEGANELLQSCQEVKAVLELLRQKGFLWCLI
HQDKIDDRIRNVGLKISDAFNMFQFVAQIQGDIFQQELRQAQKQDRQEFVTLLEQLSAND
QRILNAIMDQNGAHRRLEDLLIAVLKHVESMDKHTTPEAKFLKSAGGVLQRMSGGRPQDV
TEDWVISSLEVDFDPADIIGQGSFGRVLKAKWTGIRVAVKQMHNEDVRILSQKDRKAMYR
EIKLWATLHHPNIIDLYGACLEATSPFLIMQYCPLGNLREFLQAEPAVNRIDLSYDIVAG
INYLHNRGVIHADLKGSNILVDDKHIALVADFGLSLTIENIRSSSASTTRTSMRGTLRWM
APECLDGEPVSKASDVYSLGMTIWEVFSEDVPFSGIRDRVLSRVVVDKRERPARPERLQS
NDAVWALIQRCWAHEPDSRPSTSVVQRALEPYTSRLGSLKVSRPSGESAMVIGQLRPLSP
ASDEPTVIILDGNRFSGPIPADVKLTHLRDPEQFDMDNAHYPVLHMGGFNCWAFSYIDNR
TSYALLICDDQGGLRKMLELPGARYLHSITVANGVATFIGQANGSASIPLSTLRQHISAG
NT seq 3783 nt NT seq  +upstreamnt  +downstreamnt
atggcagagctcttgaccgttgccggcgtcgcgattaccgtcccagcgattcttcaggct
gcatggactgctctgaaggcggcctatgatctttacggcaatgtcgacacgcgccgccgt
caaatcggcgttctgctcaaccgctgccgcgacctcgtcgcaaagattgcccagcatctc
gcctcggtcaccggcgcggaaatatcgacctatgttcgcgccggcgttgacgaattgcag
cgagcgtgtgaagagatcaaggccgtgcttgagctgcttaagcagaagggctttctctgg
tgcatgctgcaccaagacaagatagacatccagctcagcgacgccgagcacaagattgcc
gatgcatttcagatgctgcacttcgtcgcccacctgcagggcgacattatgcaacaggag
ctacgccaggcgcagacgcaggaccgcgacgagttcgtcgcgctgctcgacaacctctca
gtcaacgacgagcgcatcctgaaggccgtgcaggatcaggatggcatacacaggcggctc
gaggacctactcgttgccgttctcaagcacgttgaaactctcgacacgcaaaatacgtcg
ccggaagccaagttcctgaggagcgcgagtgttgtattgggacgtcgctcgagcggccgc
ccggaggacgtatcggcggattgggtggtgtccagtctcgacgtcgagttcgacaaggca
gcgtcgataggcgaagggtcgtttggacgcgtcttcaaagcgcagtggacgggcattcgt
gtcgccgtgaagcagatgtacaacgaggacgcccgcacgttgtcgcgtcgggacagaaag
gcgatgtaccaggaggtcaagctgtgggccacgctgcaccatcctaacatcctcgaacta
tatggcgcttgcttagaggccactctaccgttccttgtcatgcgatactgctcgctgggc
gacttgcgaagcttccttccagaccatcctgacgtcaaccgagtggacatttgttacgac
atagtcgcgggcatgaactacctgcacgggcgaggcgtcgtccacgccgacctcaaatgc
gctaacatcatggtcgacgaccgccacgtcgcgctggtcgcggacttcgggctgtcgcat
acgatccaggccatccgcaccaactcggtctcgacgcgacgagacagcgctcgggggacg
ctgcgctggatggcgccggagcttctgaacgggtcacctatcaccaaggcatccgacgtg
tacagtctgggcgtcacgatgtgggaggtattcagcgagcaaatccccttcgctagcgtc
tcggacctcgtgctcagcagactcgtcgtcgatcagggccagcgcccactatgcccggcg
cggctacagtcgcacgatgtgctgtggaggcttgtacagaaatgctgggcgcatgaaccg
gcgtcgcgcccgtccatgggtgaggtgcagcggacgatgcaaccgctcacgacgcggttg
ggcacaaccgacgcttatatccctggggataccccactgcctgacagggcaggcggcacg
ggtctgccactgtccgcgcgccctcgggagcaaaaggttgcggattctacggttgatatc
tctgcttccattgtcgacatgaatgccgacgacctgccacgaccccttccggccggggtc
tacgcgatgcacctgaccgcaacatacgggctcgccactgacaatgcccattatcctgtc
ctcaagatgggcgagttcaccttctgggcattttcttacgacgataaccgcgactcgtat
gccatagtcatgtatgatggcagtcgagcgtttgtccaagtgatcgagcttccgggcgcg
cggtgggtccacagtatcgccctttcggaggatgggaaggccacattcacaggtcaagac
aaccatgccgcaacgatcactctcgcgacgttcgtcgatacgcggcgtcaccagatcggc
gtcctcctcgatcgctgtcgcgaccttgttaccaagatcgaccatcatctctccacgcag
cacggcgcggaggtgtccctcagcgtccacgagggcgccaatgagttactacaatcctgc
caggaggtcaaagccgtgcttgagctccttcgccagaagggcttcctgtggtgcttgata
caccaggacaagatcgacgatcgcataaggaacgtcggtctcaagatttcagacgcattc
aatatgttccagtttgtggcacagatccaaggcgacatctttcagcaggagcttcgccag
gctcagaagcaagaccgtcaagaattcgttaccctactggagcagctctctgcgaacgat
cagcgtatcctaaatgcgatcatggaccaaaacggagctcacaggcggttggaagacctt
ctaattgcggtcctcaagcacgtcgagtctatggacaagcacacgaccccggaagccaag
tttctgaaaagcgcaggaggcgtccttcagaggatgtccggtgggcgcccgcaggatgtc
actgaggattgggtaatctccagcctcgaagtcgacttcgacccggcagacatcatcggc
cagggctcatttggccgcgttttgaaggccaaatggacgggtatccgcgtcgccgtcaag
cagatgcataatgaagatgtcagaattctctcgcaaaaggacaggaaggcgatgtaccgg
gagatcaaattgtgggccacactccatcaccccaacattatcgacctctacggcgcctgc
ctagaggccacttcgccgttcctcatcatgcaatactgtcctttgggcaacttgcgggag
ttcctccaggctgaacctgcagtcaaccgcatcgacctgtcctatgatatcgtcgccggt
atcaattacctccacaatcgcggggtcattcacgccgatctcaaggggtcaaacatcctt
gttgacgacaaacacattgcgcttgtcgccgactttggcctatcgctcacaatcgagaac
atacggagcagctccgcatccacgaccagaacatctatgagagggacgctgcggtggatg
gcgcctgaatgcctcgacggcgaacctgtctcaaaggcgtccgatgtgtatagtttgggg
atgacgatttgggaggtatttagcgaggatgttcccttctctggcattcgggaccgcgtc
ctctcgcgggttgtggtcgacaaacgtgagcggccggcacgacctgaacgtttgcagtcg
aacgacgccgtatgggccctcatccaacgatgttgggctcatgaacctgattcacgaccg
tcaacgagcgtagttcagagggcgctggagccgtacacctcgagattgggctctctcaaa
gtgtcgcggcctagtggtgagagtgccatggtaataggccagctccggccactgagcccc
gcctccgacgaaccgaccgtcatcatcctcgacggaaaccgcttctccgggcccataccc
gcggatgtcaagctcactcacctacgggatccagagcagtttgacatggacaacgctcat
tacccggtgctgcatatgggcggcttcaactgctgggcgttctcgtacatcgacaatcga
acttcttacgcgcttctcatttgcgacgatcaaggcggcctgcgcaagatgctcgagttg
ccgggtgctcgatacctacacagcatcaccgttgcgaatggtgttgccactttcattggg
caagccaacgggtctgcctcaatccctctctctacgctgcggcagcacatttcagccggc
tga

DBGET integrated database retrieval system