KEGG   Auricularia subglabra: AURDEDRAFT_183647Help
Entry
AURDEDRAFT_183647 CDS       T03129                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
adl  Auricularia subglabra
Pathway
adl03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:adl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AURDEDRAFT_183647
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:adl03400]
    AURDEDRAFT_183647
Enzymes [BR:adl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AURDEDRAFT_183647
DNA repair and recombination proteins [BR:adl03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     AURDEDRAFT_183647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 DNA_ligase_A_C RNA_ligase BRCT PTCB-BRCT SKA1
Motif
Other DBs
NCBI-ProteinID: EJD47877
JGI: 183647
LinkDB All DBs
AA seq 1038 aa AA seqDB search
MPLPTPAPSSPGTLAGDDELQNDGQEVVIEAPENAGTYPEFGALCALLDRLQKERRQEMR
RTLLQKWFALWRERVGPDLYPLLRLLLPQKDRERAVYNIKEKTLAKAFIKALGLDPKAPD
SMRLMNWKKPTEKGKTAGDFPTVLYEVVSKRSSVMRGTMRVDQVNACLDDLAACAGKLDK
IMHAVRRISDATTPSEQRWIVRIILKDLIISVKETTILSVFHPDALSLFNTCSDLKRVAH
QLWDENCRLNDQDKGVQLFRCFAPMLCKRPTKSLEETVALMKGAKFIIEEKLDGERIQVH
KRGNEYLYYSRKGKDYTYLYGKTVSSEKASLTPYLHKAFRGDVRDCILDGEMLVWDPVSE
KLMPFGHLKTAALGNARELTNPRPCFKIFDILYVNGKSLLDKKLSQRKRLAHEIIKENKG
RVEFSYQDEGHTAKEIRDALQKVMEERGEGLVIKHPDSQYQLNGRVSDWIKVKPEYMDDM
GETVDVLVVGGNYGSGKRGGGVSTFVCAVIEDRDNSEDDTKYSTFVRIGSGFTYGDYLSI
RAKPWKPWGKKGPSWLITAPTGQDDKADVYLDPEESFVVKVKAAEITKTDQYGMKLTMRF
PRAVRIRDDLDWTQCMTASDILEMTASTSKKRKAEDDPEGSKKKRKTVKKPSALSQAFKG
ADTTNILVTSDIFAGMKFHVLDNPRVVDQKKSLETLIKQHGGAFCQKPLAREVTSVFRVF
GGSDQKPPLRVANIINEDSSDILRPSYIFDSVERNERLPLSKKYFFHRAGGKSRTEEEEA
EYQQDDEAAQASDDAMDASASVDLRNSVHPVKRESVEPELDPSLSQYSEWVSVSDGEKAK
QTRHKNDPADESETEDESSWEAADDDEQTDEWEMLSSGRLNESIVNREATLEGDDVQFTP
TVKQAAILPLAEKVAAKMGEDDSAMEYDPDIIFKHLCFYLDTPANARRNGMDVSSNLEAQ
ITDDLDEIQKMIEDNGGKIVDLTDPKLTHVIVDKRDYTRMRELRKRTSKPKQRQLVQSDF
IRAAVDAETLPDEDGFRP
NT seq 3117 nt NT seq  +upstreamnt  +downstreamnt
atgcccctacccacgccggcgccgtcctcgccgggcacactcgcgggagacgatgagctg
cagaatgacgggcaggaagtcgtcatcgaagcgcccgagaacgcgggcacgtacccggaa
ttcggagcgctctgtgcgctgctggaccgactgcagaaggagcgcaggcaggaaatgcgc
cggacgctgctccagaagtggtttgccctgtggcgcgagcgtgtcggtccggacttgtac
ccactcctgcgcctgctcctgccccagaaagaccgcgagcgcgcagtatacaacatcaag
gagaagacgctcgccaaagcgttcatcaaggctctcggactcgaccccaaggccccggac
tccatgcgcctcatgaactggaagaaaccgacagagaagggcaaaacggcgggcgacttc
cccaccgtgctctacgaagtcgtctccaagcgctcgtccgtcatgcgcggcaccatgcgt
gtcgaccaggtcaacgcctgcctcgacgatctcgcggcctgcgctggtaaacttgacaag
attatgcatgctgtccgacgtatcagcgacgcgactacgccgtccgagcagcgttggatc
gtccgtattatcctgaaagacctcattatctccgtgaaggagactactatcctctccgtc
ttccacccagacgcgctgtcgctgttcaacacctgctcagacctgaagcgcgtcgcgcac
cagttgtgggacgagaactgtcgtttgaatgaccaggacaagggcgtgcagttgttccgc
tgctttgcgcccatgctttgcaaacgtccgactaagagtctcgaggaaactgtggcgctt
atgaagggtgccaagttcatcattgaggagaagctggacggcgagcgcatccaggtgcac
aagcgcgggaatgagtacctttactactcgaggaaaggcaaggattacacgtacctgtac
ggcaagaccgtcagctcggagaaggcgagcctcacgccgtacttacacaaggcgttccgc
ggtgacgtgcgcgattgcattttggacggggaaatgctcgtgtgggatccggtcagtgag
aagctcatgccgttcggtcacctcaagacggcagctttgggtaatgccagagaactcacc
aatccacgtccatgcttcaagattttcgatatcctctacgtcaatggcaagtctctgctg
gacaagaagctttcgcagcgcaagagactggcgcacgagatcatcaaggagaacaagggt
cgtgtcgagttctcctatcaggacgaaggacacactgcgaaggaaattcgagacgctctg
cagaaagtcatggaggaacggggcgaggggctggtcataaagcatcccgattcgcagtac
caactgaacggccgcgtgagcgactggatcaaggtcaagcccgagtacatggacgatatg
ggcgagactgtcgatgtactcgtcgtcggtgggaattatggctctggaaagcgtggtgga
ggcgtctcgacctttgtctgcgccgtcatcgaggatcgcgacaactcggaagacgacacc
aagtactcgacgttcgtgcgcatcggttccgggttcacgtacggcgactacctgtccatt
cgcgcgaagccctggaagccgtggggcaagaaaggaccttcctggctgattactgcgcct
accggccaggatgacaaggccgacgtatacctcgaccccgaagagtcgttcgtcgtgaaa
gtcaaggcggcagagatcactaagactgatcagtacggcatgaagctgaccatgcgcttt
ccgcgtgcggtgcgcatccgcgacgatctggattggacgcaatgcatgaccgcgtctgat
atccttgagatgaccgcgtcgacctcgaagaagcgcaaggcagaagatgacccggaagga
tcgaagaagaagcggaagactgtgaagaaaccctccgcattatcgcaggccttcaaggga
gcagacacaacgaatatcctggtcacatccgatatcttcgccggcatgaaattccatgtg
ctcgataacccgcgcgtggtggaccagaagaagtcgcttgagaccctgatcaagcagcac
ggtggcgctttctgccagaagccgttggctcgggaggttacgtccgtattcagagtgttc
ggcgggtcggaccagaagccacccctcagagtggccaacatcataaacgaggactcgtct
gacatcctgcggccgagctacatcttcgactctgtggagcgcaacgaacggctgccgttg
agcaagaaatacttcttccacagagcaggtgggaaatctcgtacagaggaagaagaagcg
gaatatcagcaagacgacgaggctgcacaggcaagcgacgacgccatggacgcgagtgct
agcgtcgatctgcgcaattccgtgcatcctgtgaagcgcgagagcgttgagcctgagctc
gatccttcgttatcgcagtactccgagtgggtgtccgtgagcgacggcgagaaggccaag
cagacgaggcacaagaacgaccctgcggacgagtccgagacggaagacgagtcttcgtgg
gaggcggccgatgacgatgagcagaccgacgagtgggagatgttgagctctggcaggctc
aacgagtcaatagtgaatcgcgaagcgactctggagggcgatgacgtccagttcacaccg
accgtaaagcaggcagccattttgccgttagcagaaaaggtcgctgccaagatgggcgaa
gacgattctgccatggagtacgaccccgatatcatattcaaacacttatgtttctacttg
gatacacctgcaaatgcacggcggaatggcatggacgtcagctccaatcttgaggctcaa
atcacggacgacttggacgaaatccagaagatgatagaagataacggagggaagattgtt
gacctgacggacccgaagttaacccatgtcattgtcgacaagcgagactacacacgaatg
cgcgagttgaggaagaggaccagcaagccgaagcagaggcagctagtacaatccgacttt
atcagagccgcggtggatgcggagacgctgccagatgaggatggattccggccctga

DBGET integrated database retrieval system