KEGG   Auricularia subglabra: AURDEDRAFT_53682Help
Entry
AURDEDRAFT_53682  CDS       T03129                                 

Definition
(GenBank) putative alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
adl  Auricularia subglabra
Pathway
adl00500  Starch and sucrose metabolism
adl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AURDEDRAFT_53682
Enzymes [BR:adl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AURDEDRAFT_53682
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_C Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: EJD53851
JGI: 53682
LinkDB All DBs
AA seq 502 aa AA seqDB search
MAHHANEQYSAKPQNYTMFQAFEWYCEGDGVHWTKLEKRLGELNDIGISAMWIPPPTKAA
GPNSVGYDIYDLWDLGEFDQKGAVTTKYGTKDQLERLIKKAHELGINTYVDAVLNHRFGA
DKTEKFGATEVDPNDREKEVSDKYDIKGWTGFTFEGRNGKYSKFKYNFNHFTGVDYNQDG
ERTAIYKIHGDGKDWAQGVDDENANYDYLMGADIDHSHPDVVEDTVAWGKWIVDSFPGRR
FDAVKHIDSKFIAEFVDRVRKETQIDSLFAVGEFWKDSLESLEKYLDSLGTQFSVFDTPL
HYNFKEAADTGSGYDLRTIFDGTVVQARPIDAVTLVDNHDTQKGQSLESWISPQFKPLAY
ALILTRPAGYPCVFWGDLYGCAGKDPQEPMKQLGDFVRARKLFAYGEMRDYWDHPNCLGW
VRVGDEDHDGCAVVICNGNEPGTKRMEIGKEHAGEKWTDTLGWSQGEITIGEDGWAEFRC
PAMSTSIWTKVDARGRDEFKRA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcacaccacgccaacgagcagtattcggcgaagccgcagaactacacgatgtttcag
gcgttcgaatggtattgcgagggcgacggcgtgcattggaccaagctcgagaagcgcctt
ggcgagctcaatgatattggtatctcagcaatgtggattccgcctcccaccaaggcggcc
gggcccaacagcgtcggctacgacatctacgacctgtgggacctgggcgagttcgaccag
aaaggcgctgttaccacgaaatacggcaccaaggaccagcttgaacggctgatcaagaag
gcgcacgaacttggaattaacacctacgtcgacgcggtgctcaaccatcgcttcggagcc
gacaagactgagaagttcggcgcgaccgaagtcgatcccaatgaccgcgagaaggaagtc
agcgacaagtacgatatcaagggctggacggggttcacgttcgaggggcgcaacggcaaa
tatagtaaattcaagtacaatttcaaccacttcacgggtgtggactacaaccaagacggc
gagaggacggccatatacaagatccacggcgacggcaaggactgggcacaaggcgtagac
gatgagaacgcaaactacgactatctgatgggcgcggacatcgaccacagccatcctgat
gtggtcgaggacaccgtggcctgggggaagtggatagtcgacagcttccctggtcgcagg
ttcgacgcggtgaagcacatagacagcaagttcatcgcggagttcgtcgaccgcgtgcgc
aaggagacgcagatagacagcctgttcgccgtgggcgagttctggaaggactcgctcgag
tcgctcgagaaatacctcgactcgctgggcacccagttcagtgtgtttgatacgccactg
cattacaatttcaaggaggcggccgacacggggagcgggtacgacctgcgcacgattttc
gatgggacggtcgtccaggctagacctatcgacgccgtcacgctcgtcgataaccacgac
acgcaaaagggccagtccttggagtcctggatctccccgcaattcaagccgctggcctat
gcgctgatcctcacgcgccccgccggctacccgtgcgtcttctggggcgatctctacggc
tgcgccggcaaagacccgcaggaacccatgaagcaactcggcgactttgtccgtgcgcgc
aagctgtttgcgtacggcgagatgcgcgactactgggaccatccgaattgtctgggatgg
gtacgggtcggggacgaggaccacgacggctgcgctgtagttatttgtaacggcaacgag
ccgggcacgaagcgcatggagattggcaaggagcatgctggggagaaatggacggacacc
ctcggctggtctcaaggcgagatcacgatcggcgaggatggctgggctgagttcagatgc
ccggcgatgagtaccagcatctggaccaaggtcgatgcacgcggccgcgatgagttcaag
cgcgcgtag

DBGET integrated database retrieval system